KEGG   Mycoplasma hyorhinis HUB-1: MHR_0060Help
Entry
MHR_0060          CDS       T01301                                 

Gene name
dhfR
Definition
Bifunctional protein including dihydrofolate reductase and deoxycytidylate deaminase family domains
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MHR_0060 (dhfR)
   00670 One carbon pool by folate
    MHR_0060 (dhfR)
Enzymes [BR:mhr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MHR_0060 (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79360..79839
Genome map
AA seq 159 aa AA seqDB search
MIISILAMGKNNLIGKGDDLPWYVKEDFDFYREQTKHHDILVGKNTFFTLPKSLQKWSKI
YIVSDDKNFNYENENVKTINNFSNLIKEYQNHPSKHLFVSGGYTLYKSIINECDQLIISF
IKGEHSGDIFLNELKWEKFEEISSKDKGKFIVKKYKKTK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgataatttcaattttagccatgggcaaaaataatttaataggaaaaggcgatgattta
ccttggtatgtaaaagaagactttgatttttatagagaacaaacaaaacatcacgatatt
ttagtaggaaaaaatactttctttactttaccaaaatcacttcaaaaatgaagcaaaatt
tacattgttagtgatgataaaaattttaattacgaaaatgaaaatgtgaaaacaataaat
aatttttctaatctaattaaagaatatcaaaatcatcctagtaaacatttgtttgtttca
ggaggatatactttgtacaaaagcattataaatgagtgtgatcaattaataatttccttt
atcaagggagaacactctggtgatatttttttaaatgaactaaaatgagaaaaatttgaa
gaaatttcttcaaaagataaaggaaaatttatagtaaaaaaatataaaaagacaaagtaa

DBGET integrated database retrieval system