KEGG   Mycoplasma hyorhinis HUB-1: MHR_0103Help
Entry
MHR_0103          CDS       T01301                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHR_0103 (recR)
DNA repair and recombination proteins [BR:mhr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MHR_0103 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124139..124711
Genome map
AA seq 190 aa AA seqDB search
MFGKEYEELISTFKTFPGVGKKQAEKFFYFLLNKDIEFFQDLSQKIIKLKQNLQPCERCN
FVSLNVVCSICLDPDRSSQIMLVENSSDVIKFENLRFYEGKYFVFDYKKGVDNKYLTAKI
NKLRNLIRENTELIVAFSFNIEGLVLANFVMNHKDLKNVKISKLASGIPLGAQIEYVDEL
TLKEAIKNRK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaaggaatatgaagagctaatttctacttttaaaacatttcctggtgttggc
aaaaaacaagctgaaaaatttttttattttttattgaacaaagatattgaattttttcaa
gatcttagtcaaaaaattattaaattaaaacaaaatctccaaccttgtgagcgttgtaat
tttgtatctttaaatgttgtttgttcaatttgtttagatccagatcgaagttcacaaatt
atgttggttgaaaattcaagcgatgtaattaaatttgaaaatctaagattttatgaagga
aaatactttgtttttgattataaaaaaggtgttgacaataaatatttaactgccaaaata
aataaattaagaaatttaattagagaaaatacagaattaattgtagctttttcatttaac
attgaaggtttagttttagctaattttgttatgaatcataaagatttaaaaaacgttaaa
attagcaaattagcaagtggtatacctcttggagctcaaattgagtatgttgatgaatta
acactaaaagaagcaataaagaacagaaaataa

DBGET integrated database retrieval system