KEGG   Mycoplasma hyorhinis HUB-1: MHR_0166Help
Entry
MHR_0166          CDS       T01301                                 

Gene name
glcK
Definition
Glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mhr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mhr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mhr00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220371..221264
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGAKGFAQEIAHIPTSKTFNRKHHLNNYAAELFAS
GTGMSLRAQDKNLEFVDAKSIIANYDKNQNYREIVDDCIDTIARTIATTIGMLNPNLIVF
GGSVAEYNYWIIEKAIKKAKLWTNQDQWNCVEFKKDVFGDDSALFGLYYLIVEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcatggagctaaaggatttgctcaagaaattgctcacatcccaact
tctaagacctttaatagaaaacatcatttaaataactacgcagctgaattatttgcatct
ggtacaggaatgtcactaagagctcaggataaaaatttagaatttgttgatgctaaaagt
attattgcaaattatgataaaaatcaaaattacagagaaattgtagatgattgtatcgat
acaatagcaagaacaattgctacaacaattggtatgttaaatccaaatttaattgttttt
ggtggttctgtagcagaatataattattgaatcattgaaaaagcaattaaaaaagcaaaa
ctctgaaccaatcaagatcaatgaaactgtgtagagttcaaaaaagatgtttttggtgat
gattctgctttatttggtttgtattatttaattgtggaaaaaactaaaaaataa

DBGET integrated database retrieval system