KEGG   Mycoplasma hyorhinis HUB-1: MHR_0166Help
Entry
MHR_0166          CDS       T01301                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHR_0166 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHR_0166 (glcK)
   00052 Galactose metabolism
    MHR_0166 (glcK)
   00500 Starch and sucrose metabolism
    MHR_0166 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MHR_0166 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHR_0166 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MHR_0166 (glcK)
Enzymes [BR:mhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHR_0166 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
220371..221264
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGAKGFAQEIAHIPTSKTFNRKHHLNNYAAELFAS
GTGMSLRAQDKNLEFVDAKSIIANYDKNQNYREIVDDCIDTIARTIATTIGMLNPNLIVF
GGSVAEYNYWIIEKAIKKAKLWTNQDQWNCVEFKKDVFGDDSALFGLYYLIVEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcatggagctaaaggatttgctcaagaaattgctcacatcccaact
tctaagacctttaatagaaaacatcatttaaataactacgcagctgaattatttgcatct
ggtacaggaatgtcactaagagctcaggataaaaatttagaatttgttgatgctaaaagt
attattgcaaattatgataaaaatcaaaattacagagaaattgtagatgattgtatcgat
acaatagcaagaacaattgctacaacaattggtatgttaaatccaaatttaattgttttt
ggtggttctgtagcagaatataattattgaatcattgaaaaagcaattaaaaaagcaaaa
ctctgaaccaatcaagatcaatgaaactgtgtagagttcaaaaaagatgtttttggtgat
gattctgctttatttggtttgtattatttaattgtggaaaaaactaaaaaataa

DBGET integrated database retrieval system