KEGG   Mycoplasma hyorhinis HUB-1: MHR_0264Help
Entry
MHR_0264          CDS       T01301                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase r
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHR_0264 (ruvA)
Enzymes [BR:mhr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MHR_0264 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(338460..339101)
Genome map
AA seq 213 aa AA seqDB search
MEIYKFGKIVSKSKNYLILEQNYVGHLIYVPNIDRFEKDESKKIYIYKYENEYSKTTYGF
ENFRERILFEDLISVQGIGPKTAIAILNQGWETAMSYIADGDWKRISEFPYLNVKNAKQI
VFEFQNKYIKIFQNYQKTLNKDKVINVEEEVTFSSKTVLEDKIAKELEDTLKILGFQKKQ
INYALSKVQANNDFELLVEEAIKLISNAREFRN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttataaatttggaaaaatagtatccaaaagtaaaaattatttaattttagaa
caaaattatgtaggtcatttaatttatgtgcctaacatagatagatttgaaaaagatgaa
agtaaaaaaatatatatttataaatatgaaaatgaatattcaaaaacaacatatggtttt
gaaaactttagagaacgtattttatttgaagatttaatttcagttcaaggtatcggacct
aaaactgcaattgctatactaaatcaaggttgagaaaccgcaatgtcatatatagctgat
ggagattggaaaagaattagtgaatttccatatttaaatgtcaaaaatgcaaagcaaatt
gtcttcgaatttcagaataaatatatcaaaatcttccaaaactatcaaaaaactttaaac
aaagacaaagtaattaacgttgaagaagaagttacctttagttcaaaaactgttttagaa
gataaaatagcaaaagaacttgaagatacactaaaaatccttggatttcaaaagaaacag
attaattatgcgctttctaaagttcaagctaacaatgactttgaacttttagtggaagaa
gcaattaagttgatttcaaatgcaagagaatttagaaattag

DBGET integrated database retrieval system