KEGG   Mycoplasma hyorhinis HUB-1: MHR_0426Help
Entry
MHR_0426          CDS       T01301                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mhr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522079..522657)
Genome map
AA seq 192 aa AA seqDB search
MAKLIVLIGPSGVGKGSIEEILFQNPNLKIKLSVSATTRDKRPNEVDGKNYYFISKEDFK
NKIKNNEFLEWNKHFNNYYGTLKSEVDNIIKEGYSPILEIETVGALNIMKMYEQANKSDQ
LVTIFIAPPTFDDLKKRIISRKTDSYEQIQLRIDKSLEELSQQHKFQYIVVNKDLKVAAK
EVEKIILEEDKN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctaatagtattaataggtccatcaggtgttggtaaaggaagcattgaagaa
attctttttcaaaatccaaatctcaaaatcaaactttcagtatcagcaacaacaagagac
aaaagacctaatgaagtagacggaaaaaattattattttatttctaaagaagattttaaa
aataaaatcaaaaataatgaatttcttgaatgaaacaaacactttaataattattacgga
acactaaaatcagaagttgataacattattaaagaaggttatagtcctattttagaaatt
gaaactgttggagcactaaacattatgaaaatgtatgagcaagcaaacaaaagtgatcaa
cttgttaccattttcatagctcctccaacatttgatgatcttaaaaaaagaataattagt
agaaaaactgattcatatgaacaaattcaattaagaattgataaatctttagaagaatta
agtcaacaacataaattccaatatattgttgttaataaagatttaaaagtagcagcaaaa
gaagttgaaaaaataattttagaagaagataaaaactaa

DBGET integrated database retrieval system