KEGG   Mycoplasma hyorhinis HUB-1: MHR_0515Help
Entry
MHR_0515          CDS       T01301                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
mhr00010  Glycolysis / Gluconeogenesis
mhr00020  Citrate cycle (TCA cycle)
mhr00620  Pyruvate metabolism
mhr01100  Metabolic pathways
mhr01110  Biosynthesis of secondary metabolites
mhr01120  Microbial metabolism in diverse environments
mhr01130  Biosynthesis of antibiotics
mhr01200  Carbon metabolism
Module
mhr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHR_0515 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MHR_0515 (pdhC)
   00620 Pyruvate metabolism
    MHR_0515 (pdhC)
Enzymes [BR:mhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MHR_0515 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CBM39
Motif
Other DBs
NCBI-ProteinID: ADM21972
UniProt: E0TKV5
Position
complement(633167..634105)
Genome map
AA seq 312 aa AA seqDB search
MEKRFVTPLARSLAEKLGINIDLVKGTGPGGRVMREDVIAFSKNPQPTPAAPAPAASVAP
IQQTPATPNPVAASSTSEALSGKVEKVAPIRKAIARTMKNSWSSVAYVNLVNEIDVTNLW
YLRKKVVEDIQKTTGLKITFLSFISKAILIALQEFPILAAKYDEATESLVYPSTINLGIA
VDTDAGLMVPVIKDAQNLSMVQIGLEINRLAKAARERKIKASEMSGGSFTITNYGSVGAL
YGVPVINFPEIAIAGVGAIQSNVRWVNGQATEGKVMHLTVAADHRWVDGGTIGRFISRVK
ELLEKPEILGII
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagatttgtaactcctctagcaagatcgctagcagaaaaattaggcattaac
attgatttagtaaaaggaacaggtccaggtggtagggttatgagagaagatgttattgca
ttttctaaaaatccacaaccaactccagctgctccagctccagctgcatcagttgctcca
atacaacaaaccccagcaactcctaatccagttgcagcttcttcgacttcagaagctctt
agtggaaaagtcgaaaaagttgctccaattagaaaagcaattgctagaactatgaaaaat
tcatgatcttcagttgcttatgttaacttagtaaatgaaattgatgttactaacttatga
tatttaagaaaaaaagtagttgaagatattcaaaaaacaacaggattaaaaattaccttt
ttatccttcatttctaaagctattttaattgcgcttcaagagtttcctattttagcagct
aagtatgatgaagcaactgaatcacttgtttatccttcaacaattaatttaggaattgca
gtggatacagatgctggtttaatggttcctgttatcaaagatgcacaaaacttatcaatg
gtacaaattggactagaaattaatcgtttagcaaaagctgcaagagaaagaaaaattaaa
gcatcagaaatgtctggtggatcatttacaattaccaattatggatcagttggtgcatta
tatggagttccagttattaacttcccagaaatcgctattgctggagttggagctatccaa
tcaaatgttcgttgagtaaatggacaagcaactgaaggtaaagtaatgcatcttacagta
gctgctgatcatcgttgagtagatggtggaacaattggaagatttatttctagagtaaaa
gaattacttgaaaaaccagaaattttaggtataatttaa

DBGET integrated database retrieval system