KEGG   Mycoplasma hyorhinis HUB-1: MHR_0544Help
Entry
MHR_0544          CDS       T01301                                 

Definition
Phenylalanyl-tRNA synthetase, alpha subunit
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mhr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(663910..664866)
Genome map
AA seq 318 aa AA seqDB search
MDYKKVLNKFVINNLEDLKLAKNAFFGKDSYLAKLQNQLKSVSNEEKKELGKQISQIRQE
AETFFTNQAKLLEEKKINEQIAKEWIDINLPTQSFASLHPLTLIETRIRQWFLANGYFEV
KASEIENDEYNFERLNIPKNHPAREMQDSLYIDSNNLLRTHNTGVSARMLELNKNKAFSQ
FCIGKVYRNDEDDQTHSHQFSQLDFISVGNLSITDLIGTLKSFLTYVFETDLEFKFRPSF
FPFTEPSLEVDIFYKNRWIEILGSGMIHPNVLKQAGYTNNFRAIAAGVGLERLAMIKYGI
EDIRELYKNDLRFLKQFK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggattataagaaagtactaaataagtttgtcattaacaatttagaagatttaaaatta
gccaaaaatgctttttttggtaaagatagctatttagcaaaattacaaaatcaactaaaa
tctgtttcaaatgaagaaaaaaaagaactaggtaaacaaattagtcaaataagacaagaa
gctgaaactttctttacaaatcaagcaaaattacttgaagaaaagaaaattaatgaacaa
attgctaaagaatgaattgatataaatttaccaactcaaagttttgctagtttgcatcca
ctaactttaattgaaactagaattagacaatgatttttagcaaatggttatttcgaagtt
aaagcaagtgaaattgaaaatgatgaatacaattttgaaagacttaacataccaaaaaat
catccagctagggaaatgcaagatagtttatacatagattcaaataatttattaagaact
cataataccggtgttagcgcaagaatgttagagcttaacaaaaacaaagcttttagtcaa
ttttgtattggtaaagtttatcgaaatgatgaagatgatcaaactcattcccaccaattt
agtcaattagacttcatttctgtaggtaatttgtctattactgatttaattggaacttta
aaaagttttttaacttatgtttttgaaacagatttagaatttaaatttagaccatctttt
tttcctttcacagaaccttctttagaagtagatattttttacaaaaacagatgaattgaa
attttaggttcaggaatgattcatccaaatgtgcttaaacaagctggatatactaataat
tttagagctatagcagcaggtgtaggacttgaaagactagctatgattaaatacggaata
gaagatattagagaactttacaaaaatgatttacgttttttaaaacaatttaaataa

DBGET integrated database retrieval system