KEGG   Mycoplasma hyorhinis HUB-1: MHR_0547Help
Entry
MHR_0547          CDS       T01301                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
mhr00010  Glycolysis / Gluconeogenesis
mhr00030  Pentose phosphate pathway
mhr00051  Fructose and mannose metabolism
mhr00052  Galactose metabolism
mhr00680  Methane metabolism
mhr01100  Metabolic pathways
mhr01110  Biosynthesis of secondary metabolites
mhr01120  Microbial metabolism in diverse environments
mhr01130  Biosynthesis of antibiotics
mhr01200  Carbon metabolism
mhr01230  Biosynthesis of amino acids
mhr03018  RNA degradation
Module
mhr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHR_0547 (pfkA)
   00030 Pentose phosphate pathway
    MHR_0547 (pfkA)
   00051 Fructose and mannose metabolism
    MHR_0547 (pfkA)
   00052 Galactose metabolism
    MHR_0547 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MHR_0547 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MHR_0547 (pfkA)
Enzymes [BR:mhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHR_0547 (pfkA)
Protein phosphatases and associated proteins [BR:mhr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHR_0547 (pfkA)
Messenger RNA biogenesis [BR:mhr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MHR_0547 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADM22003
UniProt: E0TKY6
Position
complement(667699..668670)
Genome map
AA seq 323 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAVRAVAKKALLHNIEPLLIKEGYKGILTKQIVPAKNFDLDK
ASSEGGTIIFSSRFPEFQNNLVRQEAKAILDEFGIQALVAIGGDGTYKGAYELHKLGVKV
IGLPGTIDNDIQETDFTIGFDTALNSIVESVDRLRDTSRSHKRCFIVEVMGRDCQDLALY
GGIATGAEIIITNTHILTEEQIVNLVDQQMNQQGKTSTIVLTSEHIYKDLKAIAKFVENK
TGIATRAMSLEHTQRGGRPTAFERILATQMGHKAVELLLENKSGLAISHKNGKIEAVDIT
KVFVTKQPQDDKLVLEYNKLNQI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaataggtatcttaacatctggaggtgatgctccaggaatgaataatgct
gttagagcagttgctaaaaaagctttattacacaatatagaacctttattaattaaagaa
ggttataaaggaattttaaccaagcaaattgttccagcaaaaaattttgatttggataaa
gcttcttcagaaggaggaacaataattttttcttcaagattcccagagtttcaaaataat
ttggttagacaagaagcaaaagcaatattagatgaattcggaatccaagcactagtagca
attggtggtgatggaacatacaaaggagcctatgaacttcataaattaggagttaaagtt
attggtcttccaggaacaatcgacaatgatattcaagaaacagattttacaattggtttt
gatactgctttaaattctattgttgaatcagttgatagattaagagatacaagtagatca
cacaagagatgttttattgttgaagtaatgggaagagattgtcaagacttggcgctttat
ggtggaattgcaactggagctgaaattattattacaaatactcacattttaactgaagaa
caaatcgttaatttagttgatcaacaaatgaatcagcaaggaaaaacaagcacaattgtt
ttaacttctgaacacatttataaagacttaaaagcaattgctaagtttgttgaaaataaa
acaggtatagcaactagagcgatgtcactggaacatacacaaagaggaggaagaccaact
gcatttgaaagaattttagccactcaaatggggcacaaagcagttgaactacttttagaa
aataaatcaggcttagcaattagccataaaaatggtaaaattgaggctgtagacattacc
aaagtgtttgttactaaacaaccccaagacgataaactagtattagaatacaacaaatta
aatcaaatttaa

DBGET integrated database retrieval system