KEGG   Mycoplasma hyorhinis HUB-1: MHR_0641Help
Entry
MHR_0641          CDS       T01301                                 

Gene name
rpiB
Definition
Ribose 5-phosphate isomerase B
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHR_0641 (rpiB)
   01230 Biosynthesis of amino acids
    MHR_0641 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MHR_0641 (rpiB)
   00051 Fructose and mannose metabolism
    MHR_0641 (rpiB)
Enzymes [BR:mhr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MHR_0641 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787720..788181)
Genome map
AA seq 153 aa AA seqDB search
MSTQQDNKIIKIAFASDHAGFKLKDELLEYLKSKGYQTIDLGPDTDQQPSSYAFYGKKLA
HQLLDNQADLGIGVCGTGLGISYALNRFKHIRAARVVNENDAYLAKLHNDANAIALSGRF
TSFEEAKRIVDTFLATKYEGGRHQTRINELDTD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacaacaagataacaaaattataaaaatagcttttgcttcagatcatgctgga
tttaaattaaaagatgaattacttgagtatttaaaaagcaaaggttatcaaacaattgat
cttggtccagacacagatcagcaaccatcttcttatgcattttatggtaaaaaattagca
catcaacttttagataaccaagcagatttgggaattggagtttgtggtacagggcttggc
atttcatatgcacttaacagattcaaacacattagagctgctagagttgtaaatgaaaat
gatgcttatttagctaaattacacaacgatgcaaatgcaattgcactatcaggaagattt
acttcttttgaagaagcaaaaaggatagttgacacttttttagccactaaatacgaaggt
ggaagacatcaaaccagaattaatgaattggatacagattaa

DBGET integrated database retrieval system