KEGG   Mycoplasma hyorhinis HUB-1: MHR_0641Help
Entry
MHR_0641          CDS       T01301                                 

Gene name
rpiB
Definition
Ribose 5-phosphate isomerase B
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mhr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhr01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mhr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787720..788181)
Genome map
AA seq 153 aa AA seqDB search
MSTQQDNKIIKIAFASDHAGFKLKDELLEYLKSKGYQTIDLGPDTDQQPSSYAFYGKKLA
HQLLDNQADLGIGVCGTGLGISYALNRFKHIRAARVVNENDAYLAKLHNDANAIALSGRF
TSFEEAKRIVDTFLATKYEGGRHQTRINELDTD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacaacaagataacaaaattataaaaatagcttttgcttcagatcatgctgga
tttaaattaaaagatgaattacttgagtatttaaaaagcaaaggttatcaaacaattgat
cttggtccagacacagatcagcaaccatcttcttatgcattttatggtaaaaaattagca
catcaacttttagataaccaagcagatttgggaattggagtttgtggtacagggcttggc
atttcatatgcacttaacagattcaaacacattagagctgctagagttgtaaatgaaaat
gatgcttatttagctaaattacacaacgatgcaaatgcaattgcactatcaggaagattt
acttcttttgaagaagcaaaaaggatagttgacacttttttagccactaaatacgaaggt
ggaagacatcaaaccagaattaatgaattggatacagattaa

DBGET integrated database retrieval system