KEGG   Mycoplasma hyorhinis HUB-1: MHR_0641Help
Entry
MHR_0641          CDS       T01301                                 

Gene name
rpiB
Definition
(RefSeq) Ribose 5-phosphate isomerase B
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHR_0641 (rpiB)
   01230 Biosynthesis of amino acids
    MHR_0641 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MHR_0641 (rpiB)
   00051 Fructose and mannose metabolism
    MHR_0641 (rpiB)
Enzymes [BR:mhr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MHR_0641 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787720..788181)
Genome map
AA seq 153 aa AA seqDB search
MSTQQDNKIIKIAFASDHAGFKLKDELLEYLKSKGYQTIDLGPDTDQQPSSYAFYGKKLA
HQLLDNQADLGIGVCGTGLGISYALNRFKHIRAARVVNENDAYLAKLHNDANAIALSGRF
TSFEEAKRIVDTFLATKYEGGRHQTRINELDTD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacaacaagataacaaaattataaaaatagcttttgcttcagatcatgctgga
tttaaattaaaagatgaattacttgagtatttaaaaagcaaaggttatcaaacaattgat
cttggtccagacacagatcagcaaccatcttcttatgcattttatggtaaaaaattagca
catcaacttttagataaccaagcagatttgggaattggagtttgtggtacagggcttggc
atttcatatgcacttaacagattcaaacacattagagctgctagagttgtaaatgaaaat
gatgcttatttagctaaattacacaacgatgcaaatgcaattgcactatcaggaagattt
acttcttttgaagaagcaaaaaggatagttgacacttttttagccactaaatacgaaggt
ggaagacatcaaaccagaattaatgaattggatacagattaa

DBGET integrated database retrieval system