KEGG   Mycoplasma hyorhinis SK76: MOS_115Help
Entry
MOS_115           CDS       T02351                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124084..124656
Genome map
AA seq 190 aa AA seqDB search
MFGKEYEELISTFKTFPGVGKKQAEKFFYFLLNKDIEFFQDLSQKIIKLKQNLQPCERCN
FVSLNVVCSICLDPDRSSQIMLVENSSDVIKFENLRFYEGKYFVFDYKKGVDNKYLTAKI
NKLRNLIRENTELIVAFSFNIEGLVLANFVMNHKDLKNVKISKLASGIPLGAQIEYVDEL
TLKEAIKNRK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaaggaatatgaagagctaatttctacttttaaaacatttcctggtgttggc
aaaaaacaagctgaaaaatttttttattttttattgaacaaagatattgaattttttcaa
gatcttagtcaaaaaattattaaattaaaacaaaatctccaaccttgtgagcgttgtaat
tttgtatctttaaatgttgtttgttcaatttgtttagatccagatcgaagttcacaaatt
atgttggttgaaaattcaagcgatgtaattaaatttgaaaatctaagattttatgaagga
aaatactttgtttttgattataaaaaaggtgttgacaataaatatttaactgccaaaata
aataaattaagaaatttaattagagaaaatacagaattaattgtagctttttcatttaac
attgaaggtttagttttagctaattttgttatgaatcataaagatttaaaaaacgttaaa
attagcaaattagcaagtggtatacctcttggagctcaaattgagtatgttgatgaatta
acactaaaagaagcaataaagaacagaaaataa

DBGET integrated database retrieval system