KEGG   Mycoplasma hyorhinis SK76: MOS_190Help
Entry
MOS_190           CDS       T02351                                 

Definition
(RefSeq) transcriptional repressor/ROK family
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MOS_190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOS_190
   00052 Galactose metabolism
    MOS_190
   00500 Starch and sucrose metabolism
    MOS_190
   00520 Amino sugar and nucleotide sugar metabolism
    MOS_190
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MOS_190
   00524 Butirosin and neomycin biosynthesis
    MOS_190
Enzymes [BR:mhs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MOS_190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220622..221515
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGANGFAQEIAHIPTSKTFHKKHHLNNYAAELFAS
GTGMSLRAQDKNLEHIDAKNIIAKYEEHEDYKQIVDDCIDTIARTIATTIGILNPNLMVF
GGSVAEHNYWIIEKAIKKAKHWTNPDQWKSVEFKKDAFGDDSALFGLYYLILDKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcacggtgcaaatggttttgctcaagaaattgctcatattcctact
tcaaaaacttttcataaaaaacaccatttaaataattatgcagctgaattatttgcatca
ggcacaggaatgtctttaagagctcaagataaaaatctagaacacattgatgctaaaaat
atcatagcaaaatatgaagaacatgaagactacaaacaaatcgtagatgattgcattgac
acaattgcaagaactatcgcaactacaataggaatactaaatcctaacttaatggttttt
ggtggttctgttgctgaacataattattgaataattgaaaaagctattaaaaaagcaaaa
cattgaacaaatccagatcaatgaaaaagtgtagaatttaaaaaagatgcatttggagat
gattcagctttatttggtttatattatttaatacttgacaaaactaaaaaataa

DBGET integrated database retrieval system