KEGG   Mycoplasma hyorhinis SK76: MOS_190Help
Entry
MOS_190           CDS       T02351                                 

Definition
transcriptional repressor/ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MOS_190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOS_190
   00052 Galactose metabolism
    MOS_190
   00500 Starch and sucrose metabolism
    MOS_190
   00520 Amino sugar and nucleotide sugar metabolism
    MOS_190
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MOS_190
   00524 Butirosin and neomycin biosynthesis
    MOS_190
Enzymes [BR:mhs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MOS_190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220622..221515
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGANGFAQEIAHIPTSKTFHKKHHLNNYAAELFAS
GTGMSLRAQDKNLEHIDAKNIIAKYEEHEDYKQIVDDCIDTIARTIATTIGILNPNLMVF
GGSVAEHNYWIIEKAIKKAKHWTNPDQWKSVEFKKDAFGDDSALFGLYYLILDKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcacggtgcaaatggttttgctcaagaaattgctcatattcctact
tcaaaaacttttcataaaaaacaccatttaaataattatgcagctgaattatttgcatca
ggcacaggaatgtctttaagagctcaagataaaaatctagaacacattgatgctaaaaat
atcatagcaaaatatgaagaacatgaagactacaaacaaatcgtagatgattgcattgac
acaattgcaagaactatcgcaactacaataggaatactaaatcctaacttaatggttttt
ggtggttctgttgctgaacataattattgaataattgaaaaagctattaaaaaagcaaaa
cattgaacaaatccagatcaatgaaaaagtgtagaatttaaaaaagatgcatttggagat
gattcagctttatttggtttatattatttaatacttgacaaaactaaaaaataa

DBGET integrated database retrieval system