KEGG   Mycoplasma hyorhinis SK76: MOS_585Help
Entry
MOS_585           CDS       T02351                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
mhs00010  Glycolysis / Gluconeogenesis
mhs00020  Citrate cycle (TCA cycle)
mhs00620  Pyruvate metabolism
mhs01100  Metabolic pathways
mhs01110  Biosynthesis of secondary metabolites
mhs01120  Microbial metabolism in diverse environments
mhs01130  Biosynthesis of antibiotics
mhs01200  Carbon metabolism
Module
mhs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOS_585
   00020 Citrate cycle (TCA cycle)
    MOS_585
   00620 Pyruvate metabolism
    MOS_585
Enzymes [BR:mhs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MOS_585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CBM39
Motif
Other DBs
NCBI-ProteinID: AFX74497
UniProt: K7XLT0
Position
complement(632072..633010)
Genome map
AA seq 312 aa AA seqDB search
MEKRFVTPLARSLAEKLGINIDLVKGTGPGGRVMREDVIAFSKNPQPTPAAPAPAASVAP
IQQTPATPNPVAASSTSEALSGKVEKVAPIRKAIARAMKNSWSSVAYVNLVNEIDVTNLW
YLRKKVVEDIQKTTGLKITFLSFISKAILIALQEFPILAAKYDEATESLVYPSTINLGIA
VDTDAGLMVPVIKDAQNLSMVQIGLEINRLAKAARERKIKASEMSGGSFTITNYGSVGAL
YGVPVINFPEIAIAGVGAIQSNVRWVNGQATEGKVMHLTVAADHRWVDGGTIGRFISRVK
ELLEKPEILGII
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagatttgtaactcctctagcaagatcgctagcagaaaaattaggcattaac
attgatttagtaaaaggaacaggtccaggtggtagggttatgagagaagatgttattgca
ttttctaaaaatccacaaccaactccagctgctccagctccagctgcatcagttgctcca
atacaacaaaccccagcaactcctaatccagttgcagcttcttcaacttcagaagctctt
agtggaaaagtcgaaaaagttgctccaattagaaaagcaattgctagagctatgaaaaat
tcatgatcttcagttgcttatgttaacttagtaaatgaaattgatgttactaacttatga
tatttaagaaaaaaagtagttgaagatattcaaaaaacaacaggattaaaaattaccttt
ttatccttcatttctaaagctattttaattgcgcttcaagagtttcctattttagcagct
aagtatgatgaagcaactgaatcacttgtttatccttcaacaattaatttaggaattgca
gtggatacagatgctggtttaatggttcctgttatcaaagatgcacaaaacttatcaatg
gtacaaattggactagaaattaatcgtttagcaaaagctgcaagagaaagaaaaattaaa
gcatcagaaatgtctggtggatcatttacaattaccaattatggatcagttggtgcatta
tatggagttccagttattaacttcccagaaatcgctattgctggagttggagctatccaa
tcaaatgttcgttgagtaaatggacaagcaactgaaggtaaagtaatgcatcttacagta
gctgctgatcatcgttgagtagatggtggaacaattggaagatttatttctagagtaaaa
gaattacttgaaaaaccagaaattttaggtataatttaa

DBGET integrated database retrieval system