KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_1390Help
Entry
D648_1390         CDS       T02522                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D648_1390
   00051 Fructose and mannose metabolism
    D648_1390
Enzymes [BR:mht01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     D648_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132203..133522
Genome map
AA seq 439 aa AA seqDB search
MSNYFDKISKVQYEGANSTNPFAFKHYNPDEVVLGKTMAEHLRLAVCYWHTFCWTGNDMF
GVGSLDRSWQKTGDLLQGAKQKAEIAFEFFQKLGIPYYCFHDVDVAPEGNNFKEYQHNFN
TIVDILEQKQAETGVKLLWGTANCFTNPRYMSGASTNPNPEVFAWAAAQVFTAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQLVVEHKHKIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATATALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAI
DVLALSLKRAAKMLEDQALQKVVDNRYAGWNQDLGLQILNGKASLEDLAKIVETQGLDPK
PVSGQQEYLENLVNSYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatttcgacaaaatctcaaaagtacaatatgaaggggctaattccaccaac
ccgtttgcattcaaacattacaacccggatgaagtggttttaggcaaaacgatggcagaa
catctgcggttagcggtttgctattggcacaccttctgctggacgggtaacgatatgttt
ggcgtgggttcgcttgacagaagctggcaaaaaacgggggatttactgcaaggtgcgaag
caaaaagcggaaattgcctttgaatttttccaaaaattaggcattccttactactgcttc
cacgatgtggatgttgcaccggaaggcaacaatttcaaagaatatcagcacaatttcaac
actattgtggatattttagagcaaaaacaagctgaaacaggcgtgaaattattatggggt
acggcgaactgctttaccaatcctcgctatatgtcgggtgcttcaaccaatccgaatccg
gaagtctttgcttgggcggcagcacaagtctttaccgcaatgaacgcaaccaaacgctta
ggcggcgaaaattatgtattatggggcggacgtgaaggttatgaaaccctactcaacact
gacttaaaacgtgagcgtgaacaaatcggtcgctttatgcagttagtggtggaacataaa
cacaaaatcggttttaacggcactttattaattgagccaaaaccacaagaaccaaccaaa
catcaatatgactacgatgttgccaccgtttacggtttcttaaaacagtttggtctagaa
aaagagatcaaagtcaacattgaagcaaaccacgccactcttgcagggcatactttccaa
cacgaaattgcgactgccaccgcattagatatttttggctcgattgatgccaaccgaggt
gatccgcaattaggttgggataccgaccaattcccaaacagcgtggaagaaaacaccctt
gtgatgtatgaaatcttaaaagcaggtggtttcacaacgggcggtttcaactttgatgcg
aaaatccgccgccaaagtaccgatccgtatgatttattccacgcacatatcggggcaatt
gatgtgttagccctttcgctaaaacgtgcggcaaaaatgctggaagatcaagcattacag
aaagtagtagataaccgctacgctggctggaaccaagatttgggcttacaaattctaaac
ggtaaagcaagccttgaagatttggcaaaaatagtggaaacccaagggttagatccaaaa
cctgtttccggtcagcaagaatatttggaaaatttggtaaatagctatatttaccgttaa

DBGET integrated database retrieval system