KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_14520Help
Entry
D648_14520        CDS       T02522                                 

Definition
Lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Brite
Enzymes [BR:mht01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     D648_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1458041..1458607)
Genome map
AA seq 188 aa AA seqDB search
MSKSVKIGVFVCSVAAIIGTVKQYYSSEIRTSETGLAIIGNAEGCRRDPYKCPADVITVG
IGSTEASGEKINVNHKYTDKEIAERWIKDLKIAERCINRYFNGDKMNENQFSAMVSAAFN
MGCYNLRFYPNENGKYIQTTIHKYAMAKDFKAMCNRIPDFNRSGGKVLRGLKIRREKEKA
LCLGQEVK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagtgtaaaaattggcgtatttgtctgctccgttgcagccattatcgggacg
gtaaagcaatattacagctccgaaatccgcaccagcgaaacaggcttagctattatcggc
aatgcggagggttgcagacgtgatccgtataaatgccctgccgatgtaatcacggttggc
attggctcaaccgaggcaagcggtgagaaaattaatgtcaatcacaaatacaccgataaa
gagattgccgagcgttggataaaagatcttaaaatagctgaaaggtgtatcaatcgttat
tttaatggcgacaaaatgaacgaaaatcagttttcggcgatggtatcagcagcatttaat
atgggatgttacaaccttagattttatccaaatgaaaatggtaaatacattcagacaaca
atccataaatatgctatggctaaggattttaaagcgatgtgtaataggatacctgatttt
aaccgctcgggaggtaaagtgctaagaggtttgaaaatccgccgagaaaaagaaaaagcc
ctgtgtctcgggcaggaggttaaatga

DBGET integrated database retrieval system