KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_17500Help
Entry
D648_17500        CDS       T02522                                 

Definition
hydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D648_17500
Enzymes [BR:mht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D648_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1756549..1757253)
Genome map
AA seq 234 aa AA seqDB search
MRGKPMTTISPELTITENTLSPEAQKVRQALLAKGIETPTVTHTKDKASRRAEIQQHMQA
VLELLGLDLSDDSLEETPHRLAKMYVDEIFSGLDYATFPKITNIENRMKVSEMVLVDDIT
LTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQILTAFQTI
LETDDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLEDRETRKEFLGLLNK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgagaggaaaaccaatgacaacgatctcgcccgaattaactatcacagaaaacacgctt
tcgccggaggctcaaaaagttcgccaagccttgttggcaaaaggcattgaaactccgact
gttactcataccaaagataaagccagtcgccgagcagaaatccagcagcatatgcaggca
gttttagaattgctcggtttagatttaagtgatgacagcttagaagaaacgcctcatcgt
ttggcgaaaatgtatgttgatgaaattttcagcgggcttgattatgctaccttcccgaaa
attaccaatattgaaaaccgaatgaaagtcagtgaaatggtgctggtggacgatattact
ttaacttctacctgtgagcatcattttgttactattgacggcaaagtagcggtagcctat
tacccgaaaaaatgggtgattggactctcgaaaatcaaccgtgtcgtgcagttttttgcc
caacgtccgcaggtgcaagagcgttttaccgaacagattttaactgcctttcaaactatt
ttagaaacagacgatgttgcggtgtatgtgaaagccacccatttttgcgtgaaatgccgt
ggcataaaagacaccaatagctatacagttacttctgcctttggcggtgttttcttagaa
gaccgagaaacccgcaaagaatttttaggcttattgaataaataa

DBGET integrated database retrieval system