KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_19410Help
Entry
D648_19410        CDS       T02522                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D648_19410
Enzymes [BR:mht01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     D648_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(588856..590934)
Genome map
AA seq 692 aa AA seqDB search
MKITAKQYYRAGIMPYFFDERGVKKTASEKIKHSLFKAFNGNTQARETPIPTVNIFYQHQ
PCFLPFHLADKKHPLTGTWQLQLENSNQIISGKIKARGITLPQDLPLGYHQLQLKTVDKT
FNCTIIIAPERCYQPQAVIEQKRLWGTFLQLYTLKSAHNWGIGDFGDLKDFIQQIAPYQA
DFIGLNPIHSLFPANPNSASPYSPSSRRWLNIAYIDINQLAEFQQSDEAQTWFHSAEIQQ
QLSELRTQDWLNYEQIIPLKLKGLRFAFAKFQQNMTACAAPAFIEFVQKGGESLQVQATF
DALHQHLSAQFADQWGWDFWEKAYQDYHSAAVQQFRETHKTDIEFYLWLQFVADQQLAEC
DAICRQQNMRIGMYRDLAVGVSPNGAETWNDKQLYCLNASVGAPPDVLGPQGQNWGLTPM
NPHVLKQQAYRPFIELVRANMSHCGALRLDHIMSLLRLWWIPKGDSAVNGAYIRYPVDDL
IAILALESQRHQCLIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDEQGKSRDLQHYPY
QAMTTLSTHDLPTINGYWRGYDFELGEKFGVYPNSNILAILKQDRVNAKAKILQRLQEHN
VEIAPEISEQLNSPVNTAFIHCLQTYVANVSSGLFGFQPEDWLGMTEPVNIPGTSTQYAN
WRRRLSVNLEEIFTDKDIQALLKEVNLIRKNQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactgccaaacaatattatcgggctggaattatgccctattttttcgatgag
cgtggtgtaaaaaaaacagcatctgaaaaaataaaacattcgttattcaaagcctttaac
ggcaatactcaagcaagagaaacacctatccctacggtcaacattttttaccagcaccaa
ccctgttttttaccttttcatttagcggataaaaaacatccgttaaccggtacttggcag
ctacaactagaaaattcaaaccaaattatttccggcaaaattaaagcaaggggaattaca
ttacctcaagatttgcccttaggttatcaccaattacagctaaaaacggtagataaaacc
tttaattgcaccattattatcgctccggaacgctgctaccaaccacaagccgtcattgaa
caaaaaagattgtggggaaccttcctacaactatacaccttaaaatcagcccacaactgg
gggattggcgattttggcgatttaaaagacttcattcaacagattgccccttaccaagca
gattttatcggcttgaacccgattcactcactttttccggcaaacccgaattctgccagc
ccatacagtccatcctctcgccgatggctgaatattgcttacattgatatcaatcagcta
gcggaatttcaacaaagtgatgaagcacaaacttggtttcattctgctgaaatccaacaa
caattatcagaattacgcactcaggattggttgaattacgagcaaatcattccgttgaaa
ttgaaagggctacgctttgctttcgcaaaatttcagcaaaatatgaccgcttgcgctgcc
cctgcttttatcgaatttgtacaaaaaggtggtgaaagcttacaagttcaagccacattt
gatgcccttcatcagcatctatcggcacaatttgccgaccaatggggctgggatttctgg
gagaaagcctaccaagactaccactccgcagccgtgcagcaatttagagaaacgcataaa
accgacatagaattttacctttggttacaattcgttgccgatcaacagctagcagaatgt
gatgctatctgccgtcagcaaaatatgcgtattggtatgtatcgcgatctcgccgttggc
gtcagcccgaatggtgcagaaacgtggaatgacaaacaactttattgcttaaatgcctct
gtcggcgctccgcctgatgtattaggtccgcaaggacaaaactggggcttaaccccaatg
aatccgcatgtattaaagcaacaagcctaccgtccgtttattgagttagtcagagctaat
atgagtcattgcggtgcattacgccttgaccatattatgtctttactccgtttatggtgg
atccccaaaggcgatagtgcggttaatggtgcttatattcgttatccagttgatgattta
atcgcaattttggcacttgaaagccaacgccaccaatgcctaattatcggtgaagattta
ggtactgtgccaaaagaaattgtgagcaagctcaaaaatgcggggattttatcttacaaa
attttctattttgaatttgatgaacaagggaagagtcgagacttacagcattacccttac
caagcaatgaccacattaagcacccacgatttaccgactatcaatggttattggcgtggc
tatgattttgaattaggcgaaaaattcggcgtctatcctaattcgaatattttggcaatc
cttaagcaagatcgagtcaatgccaaagccaaaatcttacaacgcttacaagaacataac
gtagagatcgcacctgaaattagcgagcaacttaattctccggtgaataccgcatttatt
cactgtttacaaacctatgttgcaaatgtaagcagcggattattcggcttccaacccgaa
gactggttgggtatgactgagccggttaacattccgggaaccagtacacaatatgcaaac
tggcgacgtcggcttagtgttaacctcgaggagatcttcacagataaagatattcaagcc
ttattaaaagaagttaatttaatccgtaaaaatcaataa

DBGET integrated database retrieval system