KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_3880Help
Entry
D648_3880         CDS       T02522                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    D648_3880 (hisD)
Enzymes [BR:mht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     D648_3880 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2159773..2161056)
Genome map
AA seq 427 aa AA seqDB search
MQTLIWNNLTETEQQQYLARPAQVVGESIKAAVNEIKANVIANGDKALFELAEKFDKVKL
ESLVVSEQQIQQAQSRISPELKQAIQNAKANIEAFHKAQQNQEVDIETQPGVCCQVITRP
INAVGLYIPGGSAPLFSTVLMLAVPAKIAGCNKIVLCSPPPIADEILYTAHLCGVETIYA
VGGAQAIIAMANGTQTVAKVDKIFGPGNAFVTEAKRQVVQEGTAIDMPAGPSEVLVIADE
FADPAFVASDLLSQAEHGADSQVILVTPSESLARAVDEELEKQVAVLPRAETARKALAHS
RTFIAENLQQAVEISNKYAPEHLIVQTENARSLLADLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTKTYSSLGLADFSKRMTVQELTPQGFLALAETVERMASAELLDAHRNAVSL
RVAKLKG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctaatttggaacaatttaacagaaactgagcagcagcaatatcttgcccgt
ccggcacaggtggttggcgagagtattaaagcggcagttaatgaaattaaagcgaatgta
attgccaacggcgataaggcattatttgaattggctgaaaagttcgataaagtaaaatta
gagagcttagttgtatcagaacagcagattcagcaagcacagagccgtatttcaccagag
cttaagcaagcgattcaaaatgcgaaagcgaatatcgaggctttccacaaggcacagcaa
aatcaagaggtggatattgaaacccagccgggggtgtgttgccaagtcatcactcgcccg
attaatgcggtggggctttatattccgggcggttcagccccgcttttctctaccgtgtta
atgcttgcagtgccggcaaaaattgccggttgtaacaagattgtgctttgctcaccaccg
ccgattgccgatgaaattctctacaccgcccatttgtgtggggtggaaacgatttacgca
gttgggggggctcaagcgattattgcgatggcaaatggcacacaaacggtagcgaaagtg
gataaaattttcggcccgggcaatgcgtttgtgacggaggcgaaacgccaagttgtgcaa
gaaggcacggcgattgatatgccggcaggcccgtcggaagtgttggtgattgccgatgag
tttgctgaccctgcatttgtggcgagcgatttactctctcaagcagaacatggagccgat
tcccaagtgattttagtcacaccaagtgagagcttggcaagggcagtcgatgaagaatta
gaaaagcaggtggcggttttacctcgtgccgaaactgcccgtaaagcattggctcacagt
cgcacttttattgcggaaaacctgcaacaagcggtcgaaattagtaataaatatgcaccc
gagcatttaattgtgcaaactgaaaatgctcgctcgttgttggcggatttagataatgcc
ggctcgattttcttaggggcgtattcgccggaaagtatgggggattatgctagcggcact
aaccacgttttaccgacttacggctacactaaaacctattcgagcttaggtttagctgat
tttagcaagcgaatgacggtgcaggagctgacaccacaaggctttctagccttggccgaa
acggtggaacgaatggcaagtgcagaattgctagatgcacaccgcaatgcggttagttta
cgagtggcaaaattaaaaggctaa

DBGET integrated database retrieval system