KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_6390Help
Entry
D648_6390         CDS       T02522                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D648_6390
Enzymes [BR:mht01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     D648_6390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(652479..654518)
Genome map
AA seq 679 aa AA seqDB search
MSNKQNTAHYFYSPNIKEYASPSAFEKIERLLNTDNDLQKNNQILPLVKVITQPNAEQQA
VEISLNFTNVAKWQIVLENGEVRNGEIKAEQSVLTLPADLPLGYHQLSISTENDEESCSL
IVTPPKAFQPKPLEERKKLWGAFLQLYTLRSDNNWGIGDFGDLKQFLANISDYGADFVGL
NPIHALFPADPDAASPYSPSFRLWQNIIYIDVSAVEAFQQSEQAQQWFHTKETQQQLAEL
RAKDFVDYSQVAQLKLKALQFAFEHFSQSSQQQSQTAFDAFIEQAGEPLKIQATFDALHH
WISSEFGEKGGWTNWAEEYQSYYSPKVAEFQISQATQIRFYMWLQFVANQQLAECNRFAQ
SLSMPIGFYRDLAVGVTQSGAETWADKALFVQEASIGAPPDMLAPNGQSWGLSPMHPHIL
QSRGYQPFIDLVRANMKHCGALRIDHILGFARMWWVANGESAKEGIYVRYPLEDLLSILA
LESQRHQCLVIAEALGIVPEGILDSLEQKGIFAYNVFYFEKAENAFKPLENYPYQAMTTL
STHDLPTIQGYWKGYDFELGEKFDTYPSKAVLRKLKEERSYDRLNIRNAVEKVIALEPNE
VGVTIKFTHQLQRYVAHTHSALFGTQPEDWLNMLEPVNIPGTSTEYPNWRRKLSATTEQI
FANKDIQQLLKDINEIRKG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaaacaaaatacagctcactatttttactccccaaatattaaagagtatgcc
agcccctctgcttttgagaaaatagagcggcttttaaataccgataacgatttgcaaaaa
aataatcaaattctaccgcttgttaaagtgattactcagccaaatgccgagcaacaagcg
gtcgaaatttcgctgaattttacaaatgtagcaaagtggcaaattgtgcttgaaaatggt
gaggttcggaacggtgaaattaaggcagagcaatcagttctaaccctgcctgccgatttg
cctttaggctatcatcagctttctatttcaactgaaaatgatgaagaatcttgctcgctg
attgtaacaccgccgaaagctttccagcctaagccattggaagaaaggaaaaagctctgg
ggtgcatttttacagctttatactttgcgttccgataacaactggggaattggcgatttt
ggcgatctcaaacaattccttgccaacatttctgattatggtgcagattttgtgggctta
aaccctattcacgccctctttccggcagatcctgatgcggcaagcccttacagcccgtcc
tttcgactttggcaaaatattatttatattgatgtttcagcagtagaagcctttcaacaa
tctgaacaggctcaacaatggtttcacaccaaagaaactcaacagcaacttgccgaattg
cgagccaaagattttgtcgattacagccaagtagcgcaactgaaattaaaggctctgcag
tttgcttttgagcatttttcacagtcatctcaacaacaatcgcaaacagcgttcgatgcc
tttattgagcaagcaggcgagccattaaaaatccaagcaacgttcgatgctttgcaccac
tggatttcatctgaatttggcgaaaaaggcggctggacaaactgggcggaggaatatcaa
agttactattcgcctaaagtagctgaatttcaaatatcgcaggcaacgcagatacgtttt
tatatgtggttgcaatttgtggcaaaccagcaattagcagaatgcaaccggtttgctcaa
tcactttcaatgccgattggtttttaccgcgatttagccgttggtgttactcaaagcgga
gcggaaacttgggcggataaagccctatttgtgcaagaggcgtcaatcggtgcaccacct
gatatgcttgccccgaacggacagagctggggactttcgccaatgcacccgcatattcta
caaagccgaggttatcagccgtttattgatttagtgcgtgctaatatgaaacattgtggg
gcattgcgaatcgaccatattctcggcttcgcccgtatgtggtgggtggcgaacggtgaa
tcggcaaaagaagggatttatgtccgttatccgctcgaagatttgctctctattttggca
ttagaaagccaacgtcaccaatgtttagtgattgcagaggcacttggcattgtgcctgaa
ggcattttggactctctcgagcaaaagggcatttttgcctacaatgttttttattttgaa
aaggcagaaaacgcgtttaaaccgctggaaaattatccttaccaagcgatgacaactcta
agcacccacgatttaccgactattcaaggctattggaaaggctatgattttgagctaggc
gaaaaatttgacacttacccaagcaaagccgtattgagaaagctgaaagaagagcgttcg
tacgaccgcttgaatatccgtaatgcggtggaaaaagtgatagcactcgagccaaatgaa
gtgggagtaacaataaaatttacccaccaattacaacgctatgtggctcacactcacagt
gcattattcggtacacagcccgaagattggctcaatatgttagagccggtgaacattccg
ggaaccagcaccgaataccctaactggagaagaaaattatccgcaaccaccgagcagatt
tttgcaaataaagatattcaacaactgctaaaagatataaacgaaattcgtaaaggataa

DBGET integrated database retrieval system