KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_910Help
Entry
D648_910          CDS       T02522                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D648_910
Enzymes [BR:mht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     D648_910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89583..90188)
Genome map
AA seq 201 aa AA seqDB search
MTRIGLNQGTAGNVSVRYKDGMLITPTGTPYEQMTEDSIVFVDGNGKHEEGKLPSSEWQF
HLAVYEARPELNAVVHNHAKNCAAVSILGEPIPAIHYMIACTGTNHIPCVPYAPFGTHQL
ADYVREGIKHSKAILLAHHGLITADKTLEKALGIAHEVEVIAEWYLKLLATGKPIPTLNK
EQMDIVLGKFKSYGSWVESEQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaattgggttaaatcaaggtacagcaggcaatgtgagcgtacgttataaagac
ggtatgctcattacgccaacaggtacaccttatgagcaaatgaccgaagattctatcgtc
tttgttgatggcaacggcaaacacgaagagggaaaactcccttcaagtgagtggcagttc
catttagcggtttatgaggctcgccctgaattaaatgcggtagttcacaaccacgctaaa
aactgtgccgcagtgtctattttaggtgaacctatccctgccattcactatatgatcgcc
tgcaccggcactaatcacattccttgtgtaccttatgccccgttcggcactcaccaatta
gccgactatgtacgtgaaggcattaaacacagcaaagcaattttactcgctcaccacggc
ttaatcaccgcagataaaaccctcgaaaaagccctcggcatcgcccacgaggtggaagtg
atcgcagaatggtatttgaaactgctcgctacaggaaaacctatcccaacgctaaacaaa
gaacaaatggatatcgtactcggaaaatttaagtcctatggttcttgggtggaaagcgaa
caatag

DBGET integrated database retrieval system