KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_9170Help
Entry
D648_9170         CDS       T02522                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
mht00330  Arginine and proline metabolism
mht00332  Carbapenem biosynthesis
mht01100  Metabolic pathways
mht01130  Biosynthesis of antibiotics
mht01230  Biosynthesis of amino acids
Module
mht_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D648_9170
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    D648_9170
Enzymes [BR:mht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D648_9170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGI34921
Position
1622470..1623573
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMIDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLIQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtaaaatttggaaccagtacgcttacgcaaggatcg
gcgaagttaaatttacctcatatgatagatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgttacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgcaattgccaccgacgattgcctcgaaacaattattggctgcggtaggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatact
ttgcgcgccttattagacaatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcaattttggtg
caagcagaacagttgtatttgcttactgatcagcaaggtttatttgatcgtgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgcgggcggaagtggcacctcgttaggcacaggtggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccatt
gatgcgggggcggaaaacgcgatgttaatacaacataaatcgttattgcctgctgggatt
gtaaacgtggaagggcgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggc
aaggatgttgccttagggatgccacgttataacagcgatgcgctccatttaattcaaggc
aaacattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacac
cgagacgatatgattgtgttataa

DBGET integrated database retrieval system