KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_9170Help
Entry
D648_9170         CDS       T02522                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mht00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D648_9170
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D648_9170
Enzymes [BR:mht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D648_9170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(922896..923999)
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMIDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLIQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtaaaatttggaaccagtacgcttacgcaaggatcg
gcgaagttaaatttacctcatatgatagatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgttacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgcaattgccaccgacgattgcctcgaaacaattattggctgcggtaggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatact
ttgcgcgccttattagacaatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcaattttggtg
caagcagaacagttgtatttgcttactgatcagcaaggtttatttgatcgtgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgcgggcggaagtggcacctcgttaggcacaggtggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccatt
gatgcgggggcggaaaacgcgatgttaatacaacataaatcgttattgcctgctgggatt
gtaaacgtggaagggcgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggc
aaggatgttgccttagggatgccacgttataacagcgatgcgctccatttaattcaaggc
aaacattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacac
cgagacgatatgattgtgttataa

DBGET integrated database retrieval system