KEGG   Mannheimia haemolytica USDA-ARS-SAM-185: D648_940Help
Entry
D648_940          CDS       T02522                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
mht  Mannheimia haemolytica USDA-ARS-SAM-185
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mht00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92429..94195)
Genome map
AA seq 588 aa AA seqDB search
MTTLKSTPVKIGIRPTIDGRRLGVRESLEDQTMNMAKAVAQLIQSEVRHPNGDFVECVIA
DSTIGGVAEAAACAEKFKRENVGAVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGA
VYLAAALAGHSQLGLPAFSIYGTEVQEADDQSIPDDVREKLLRFARAGLAVATLRGKSYL
SIGSVSMGIAGSIVNQQFFQEYLGMRNEYVDMTEIKRRLDRHIYDAEEFKLAMSWVKTYC
KEGIDVNAPENQRSPEEREKLWEDVVKMTIIARDLMVGNPRLAELGYSEEALGHNAIAAG
FQGQRQWTDHLPNGDFMEATLNSTYDWNGVRAPYIMATENDSLNGVNMLFGNLLTGQAQI
FADVRTYWSEDSVERVTGWRPESGFIHLINSGSAALDGTGQHTDRAGKPTIKPAWEVTEE
DGKRCLENTCWCPAVHEYFRGGGLSSQFLTKGGMPFTMHRINLIKGIGPVLQIAEGWSID
LPENVHDILNKRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATFGHVGADLIT
LASMLRIPVCMHNVEDKDVFRPSAWNGFGQDKEGQDYRACANFGPLYK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgttgaaatctacccctgtaaaaattggtatccgcccaaccattgacggtcgc
cgtttaggagtgcgtgaatcacttgaagatcaaacaatgaatatggcaaaagccgttgca
caattaattcaatctgaagtccgccacccaaatggtgatttcgttgaatgtgtgattgct
gattccaccatcggtggtgttgccgaagctgcggcttgtgcagaaaaattcaaacgtgaa
aatgtcggagcggtgattaccgtaaccccttgctggtgctacggttctgaaaccattgat
atggacccacatatgccgaaagccatttggggctttaacggaacagaacgcccaggtgca
gtttatttagctgctgctttagcaggtcatagccaattaggtttaccggcattctccatt
tatggcacagaagtacaagaagctgacgatcaatctattccagacgatgtgcgtgaaaaa
ttactccgctttgcccgtgccggcttagcagtggcaaccttacgaggaaaatcatattta
tctatcggctctgtttcaatgggtattgccggttctatcgtaaaccaacaattcttccaa
gaatatttgggtatgcgtaacgaatatgtggatatgaccgaaattaaacgccgtttagat
cgccatatttacgatgccgaagaatttaaattagcaatgagctgggtgaaaacctattgc
aaagaaggtattgatgtcaacgcaccggaaaatcaacgcagcccggaagagcgtgaaaaa
ctctgggaagacgtggtgaaaatgaccattattgcccgtgatttaatggtgggtaatcct
cgcttagcagagctaggctatagtgaagaagccttagggcataatgcgattgctgccggt
ttccaagggcaacgccaatggacagaccatttgccaaacggcgattttatggaagctacc
ttgaattcgacctatgactggaacggcgttcgcgcaccatacattatggcaactgaaaac
gacagcttaaatggcgtgaatatgttgttcggtaacttattaaccggtcaggcacaaatc
tttgccgatgtgcggacatactggagcgaagactcggtagaacgtgtcaccggctggcgt
ccggaaagcggttttatccacttaatcaactccggctctgcggcgttagacggaacaggt
cagcataccgatagagcaggcaaaccaactattaaaccggcttgggaagtgactgaagaa
gacggtaaacgttgtttagaaaacacctgttggtgtccggcagttcacgaatatttccgt
ggtggtggtttatcttcccaattcttaaccaaaggtggaatgccgtttacgatgcaccgt
atcaacctgatcaaaggtatcgggccggttttacaaattgccgaaggttggtctatcgac
ttgccggaaaatgtacacgacattttaaacaaacgcaccaatgaaacctggccgaccact
tggttcgtacctcgcttaaccggaaaaggcgcatttaccgatgtgtatagcgtaatggcg
aactggggtgcaaaccactgtgtggcaaccttcggacacgttggggcagacttaattacc
ctcgcctcaatgctccgcattccggtttgtatgcacaatgtggaagataaagacgtattc
cgcccaagtgcgtggaacggtttcggtcaagacaaagaaggtcaagactaccgtgcttgt
gctaacttcggaccattatataaataa

DBGET integrated database retrieval system