KEGG   Methanospirillum hungatei: Mhun_0077Help
Entry
Mhun_0077         CDS       T00325                                 

Definition
PfkB
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mhu  Methanospirillum hungatei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mhun_0077
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mhun_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(98547..99446)
Genome map
AA seq 299 aa AA seqDB search
MISVVGHTAVDHICKVSHLPGPNASASILERTIAFGGGAANIAVGIALLGGRVSLISAVG
GDFAGSAYDSRMKELGIDQRFFIAPEKHTATAFMFTGPEGDQMTYFEWGASYLFETEKAP
SLPFVHMATADPGFNVQVAKQSGFASFDPGQDLHRYTADHLNTILDSIDLLIANHHEYAG
MCKTLGIDRDELISRVPMAIETRSGDGAVLYDQGKEHFIPAVPVPCVDPTGAGDAFRAGF
LTAYAAGYSSEDACRIGVVTASFVVETCGCQTGLPNWQTMVRRYGEKFGPFPSHGPKRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgatatccgtagtcggtcatactgctgttgatcatatctgtaaagtctcccacctccct
ggtccgaatgcatcagcatcaatacttgagagaacgattgcgtttggtggtggggcagca
aatattgccgtgggaatcgccctcctgggagggagagtgtcacttatcagtgcagttggc
ggagattttgcagggagtgcatatgactccagaatgaaagaacttggtattgaccagcgg
ttcttcatcgctcctgaaaagcacacggcaactgcatttatgttcaccggccctgaaggg
gatcagatgacctatttcgagtggggtgcatcatatctctttgagaccgaaaaagcccct
tcactccccttcgtgcatatggcaactgcagaccccggatttaatgtacaggttgcaaaa
cagtcaggatttgcctcatttgatcccgggcaggatcttcaccggtacacagcagatcat
ctgaacaccattctggattcaatcgaccttctcatcgcaaatcatcatgaatatgccggc
atgtgcaaaaccctgggaattgaccgtgacgaactgatatcccgggtcccgatggctatt
gagaccagaagcggagacggagcagtgctctatgaccagggaaaagagcacttcatccct
gcggtaccggtcccctgtgttgacccgactggtgctggagatgcattcagggcaggattt
cttactgcctatgctgcagggtattcttccgaagatgcatgcagaatcggggtggttacc
gcgtcctttgtcgtggagacctgcgggtgtcagaccggccttcctaactggcagactatg
gtcagacggtatggagaaaagtttggcccattcccctctcatggtccaaaacgggcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system