KEGG   Methanospirillum hungatei: Mhun_0095Help
Entry
Mhun_0095         CDS       T00325                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mhu  Methanospirillum hungatei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_0095
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mhun_0095
   00640 Propanoate metabolism
    Mhun_0095
   00660 C5-Branched dibasic acid metabolism
    Mhun_0095
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_0095
Enzymes [BR:mhu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mhun_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
113409..114488
Genome map
AA seq 359 aa AA seqDB search
MKLKEYEAKDILQKAGIPIPRGVLVKKGSDYLVSPDIKEAAIKAQVEVAGRGKAGGILMA
DHAGIRDTTEKLFQTTIKGLPVEEILIEEKLQIQHEYYLSITIDRSQKAPVILFTTEGGV
DIEEVAQKNPAAIRKATVYPLLSKVPGYTLRYLLNGAPKEIGAIIQKLYTVFMSQDALLA
EINPLVMTPDGLFAADAKLILDDNALARHGIQENRDLSERERKAAAHGFSFVELNGNIGV
IGNGAGLTMATVDLINRMGGRPANFLDVGGGADRVRVAHAVRLLGSMPDVTVIIVNLLGG
ITRCDEVAAGIIEAGVSQQIIVRLAGTNEAEGKALLSSKGYLMLDTMEEAVTAAVEAAS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaggaatatgaagcaaaggatatcctgcaaaaagcaggcataccaattccc
cgtggtgtattagtaaagaagggttcggattatctggttagtccggatattaaagaggca
gcgatcaaggcacaagtggaagtagcgggacggggcaaggccggcggcattctcatggca
gatcatgcaggtatcagggatacgactgaaaaactctttcaaaccaccataaaaggcctc
cctgttgaagagatcctcatcgaagagaaacttcagatccaacatgagtattatctctcg
atcaccatcgatcgctctcaaaaagcgcctgtcattctcttcacaaccgaggggggagtg
gatattgaagaagttgcacaaaaaaatcctgccgcaatacgaaaagcaaccgtatatccc
ctcctctccaaagttcccggatacaccctccgataccttctgaatggtgccccaaaggag
attggagccattattcagaaattatatactgtttttatgtcacaggacgcattgcttgca
gagatcaatccgttggtcatgactcctgatggtctgtttgccgcagatgcaaagctgatt
cttgacgataatgccctggcccgtcatggcattcaggagaaccgggatctctcggaacgt
gaacgtaaggctgctgctcatggattctcgttcgtggaactgaatggcaatatcggtgtt
atcggcaacggggccgggcttaccatggcaaccgtggatctcatcaaccggatgggtggc
agacctgcgaacttcctggatgttggtggaggagcagaccgggtcagagttgcgcatgcc
gtccgtctgcttgggtccatgccggatgtgacagtcattattgtaaacctacttggtggg
attacccggtgtgatgaagtggcagcaggtattattgaggcaggtgtcagtcagcagatc
attgtcaggctggcggggacaaatgaggcggaaggaaaagccctcctctcatcaaaagga
tatctgatgcttgacacgatggaagaagcggtgactgccgcggtggaggcagcatcatga

DBGET integrated database retrieval system