KEGG   Methanospirillum hungatei: Mhun_0186Help
Entry
Mhun_0186         CDS       T00325                                 

Definition
(GenBank) transport system permease protein
  KO
K02015  iron complex transport system permease protein
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02010  ABC transporters
Module
mhu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mhun_0186
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Mhun_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: ABD39960
JGI: Mhun0186
UniProt: Q2FMP4
Position
208329..209417
Genome map
AA seq 362 aa AA seqDB search
MSQHNPENSQSNASMSEIQSSYYRYHSRKVLFLLSVSFGILFLVGIAASFGSYELDLVSV
YTTIFAGIFPGMGIPESVANTIIWDIRLPRISMAIVCGASLGVAGAILQGVLRNPLAEPF
TLGISSAAAMGASLAIIGGLKLFGAYSVVLNAFISAFLATMVIYSIAKSKGMTPEAIILA
GIAIMFLLDAVTSFMQYLGTAEQVQAVVFWMMGSVSVANWETVFIVFCIAVIAIPYLIYK
ASDLTIIGAGDETAHSLGINVEHVRMRTLIFAALLTASVTAFCGIIGFVGLVSPHITRMA
IGGDNRYVIPGSALVGGILLLGADTVARTILAPMILPVGIMTALVGVPFFMFLFMRKRKE
LW
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacataacccggaaaattctcaaagtaatgcttcaatgtctgaaatacaatcc
tcgtattatcggtatcattctcgaaaggtcctgtttcttctctccgtttcatttggaatt
ctatttttggttgggatagcggcatcttttggatcctatgagctggatcttgtttcggta
tacaccacaatatttgcaggcatttttcccgggatgggaataccagaatctgttgcgaat
acgataatatgggatatccgactcccaagaatatccatggccattgtatgcggggcaagt
cttggtgtagctggtgcaatactgcagggagtgcttcgaaacccgcttgctgaaccattt
accttagggatatcttcagctgccgcgatgggcgcatcccttgcaatcatcggggggctt
aaattatttggagcatacagtgtggtcctcaatgcattcataagtgcatttcttgctacc
atggtcatttactccattgcaaaaagtaaaggaatgaccccggaagcgataatccttgct
ggtattgctatcatgttccttttggatgcggttacgtcatttatgcaatacctcggaaca
gccgaacaggtacaggccgtggtcttctggatgatgggaagtgtatcggtagccaattgg
gagactgtttttattgttttttgcattgcagtcatagccatcccgtatctcatctacaag
gcatcagatctcaccattataggagccggagatgaaaccgctcacagcctgggaataaat
gtggagcatgtacggatgcgaacacttatatttgctgctcttctcaccgcttcagtcact
gctttttgtggaatcatcggatttgtagggctggtttccccgcatatcacaaggatggct
atcgggggagataaccggtatgtgattccaggatctgcccttgtcggaggaattctcctc
ctgggtgctgataccgttgctcgaacgatccttgcccctatgattttaccagtgggtatt
atgaccgcccttgtgggtgttcccttctttatgtttctttttatgcgaaagaggaaagaa
ttatggtaa

DBGET integrated database retrieval system