KEGG   Methanospirillum hungatei: Mhun_0238Help
Entry
Mhun_0238         CDS       T00325                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02024  Quorum sensing
Module
mhu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Mhun_0238
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Mhun_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABD40010
JGI: Mhun0238
UniProt: Q2FMW9
Position
complement(263648..264616)
Genome map
AA seq 322 aa AA seqDB search
MVMIHPAGIFLSRKLLRYILSFFCILLIVFLLPRMMPGDPVSNLVGEDIYLSQSTIDSLR
AAFGLDTPLHEQFLIYCLQIMHGNLGYSYHMHGPVFEILISRAWWTLLYTIPSIIIGAWI
GISLGARAGFQSGKWWSDAISLIALVISSTPPYLLSLLVLVLFVYHLGLFPFKGFYDTYN
LQSILYHLILPTFVLISFYTSRNILIMRGAVLTEKELLYPQFARSLGISERNILLHHIRK
NAIIPLIALIALDFGFLFSGALFIEIVFSLNGMGSLMYDAILARDYPILTGSLLIIAIFV
IIANITADIMSLIIDPRIRRSS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatccacccggcaggtatttttttatcccgaaaattgctcagatatatcctt
tcttttttctgcattctgttgatagtttttctcctacccagaatgatgcccggtgatccg
gtctcgaacctggttggagaagatatttacctgtcacagagtactattgattcattacga
gcagcatttgggcttgataccccgcttcatgaacagtttctcatatattgtctccagatc
atgcatggaaatcttggatactcctatcatatgcatgggcctgtttttgaaattctcatc
agcagagcatggtggactcttttgtataccattccctccattattatcggtgcatggatt
ggtatatcccttggagcacgagcgggttttcagagtggaaaatggtggtcagatgcaata
tctttaatagctcttgtcatatcttcaaccccaccctatcttctcagtcttcttgtcctg
gtcctatttgtctaccatctcggtttattccctttcaaagggttttacgatacctataat
cttcaaagtatcctctaccatctcatattgccaacgttcgttttgatctcattttatact
tcaagaaatattcttatcatgagaggtgcggtattaaccgaaaaggaactcctttatcca
cagtttgcccggtcactgggtatttctgaacggaatatattgctccatcatatcagaaaa
aatgcaataattccactgatagcactaatcgctcttgactttggatttcttttttcaggt
gcactttttatcgagattgtcttttccctgaatggaatggggagccttatgtatgacgca
atccttgccagggattatccgatactgaccggatcactccttatcattgcaatctttgtc
attattgccaatatcactgcagatatcatgtcacttattatagatccccgaatcaggaga
agttcatga

DBGET integrated database retrieval system