KEGG   Methanospirillum hungatei: Mhun_0239Help
Entry
Mhun_0239         CDS       T00325                                 

Definition
(GenBank) extracellular solute-binding protein, family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02024  Quorum sensing
Module
mhu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Mhun_0239
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Mhun_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 DUF2007 BPL_LplA_LipB
Motif
Other DBs
NCBI-ProteinID: ABD40011
JGI: Mhun0239
UniProt: Q2FMW7
Position
complement(264636..266219)
Genome map
AA seq 527 aa AA seqDB search
MRETYHKIWSLLFLILSFVTICCSMGVIADDAILRIATTNEVKSPAFIGDYTLGIFNHLS
NPPLMQMDEKGKLIGLLADHFEVSPDNTEWTFVIKDNQFWSDGIPVTADDVAFSIQMYGT
SIPNAGWIGETLIDTQVDGNKVTFKFNKPYTNLALEFTSYSILPKHIWESIENPNEFTST
GPYVGAGPYYLDNVDLNAGKVIFKRNPSWKGKISDYETVEISWFKNEDAAAKALESGIMD
TYWKYASSYPYAAIDSLRKTGNFEMLEKPTSGLTFLGFNLKREPMSDPAFREAVSSAINY
QELVDISTLGYGLVPNRGFVPPAMDGYIQTKPMEYNLETAKKTLDSAGYKDSDGNGIIEA
ADGKDITLDLLIRNSYAREAELIKEYLEKAGIGVEVRTVEDNTWFEMKDKLDYDITLTRT
TPWGMLMHAGWATGYFDSRRTGQGVLHTVDDEVFLKLCDDILSTTDQTLLNGYAKEVQEY
YAENLPGIPLYWKNDITPYNKKITGWYSNPLYGIMNEFTFTGVKSSA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaacatatcacaaaatctggagtttgctcttccttattttgagctttgtcaca
atctgctgttctatgggagtaattgcagatgacgccatacttcgtatcgcaaccacgaat
gaagtcaagtcaccagcatttattggcgattataccctcggcatttttaaccatctttca
aatccaccccttatgcagatggatgagaaaggaaaattaatcggcctgctagcagaccac
tttgaggtatcacctgataatacagaatggacatttgttatcaaggataaccagttctgg
agtgatggaataccagtaacggcagatgatgttgctttctctattcagatgtatggcacc
agtattccgaatgcaggctggattggagagacactaattgacacacaggttgacggtaat
aaagtaaccttcaaattcaacaaaccatacacaaatcttgcccttgaatttacctcgtat
agtattctcccaaaacatatctgggaatctattgaaaacccgaatgaatttaccagtacc
ggcccgtatgtcggagcgggaccttattatctggataatgttgatttaaatgcaggaaaa
gtgatttttaagagaaatccaagttggaagggaaagatatcagattatgaaacggtcgag
ataagctggtttaaaaatgaagatgcagcggcaaaggcattggaaagcggtataatggac
acctactggaagtatgcatcatcatacccgtatgcagccattgactcactcagaaaaacc
ggcaattttgaaatgctggaaaaaccaacaagtgggctcacatttttaggatttaacctg
aaaagggagccaatgtctgatccagcattcagagaagcagtcagtagtgccataaattac
caggaactagttgatatttcaacactaggatatggattagtgccgaacaggggctttgtt
cctccggccatggatgggtatatccagacaaaaccaatggaatataatctcgaaactgcc
aagaagacccttgattcagcaggatataaagattctgacggaaatggtatcatagaggca
gcagatgggaaagatattactcttgacctattaattagaaattcctatgcccgtgaggca
gaacttattaaagagtaccttgaaaaagcaggaatcggagttgaggtaagaacagttgaa
gataatacatggtttgagatgaaagacaaacttgactatgatatcacactgacacgaacc
acaccatggggaatgcttatgcatgccggatgggcaacgggatattttgacagcaggaga
acggggcagggtgtcctccataccgttgatgatgaagtcttcctcaaactctgtgatgat
atcctgagtacaactgatcagaccttactcaacgggtatgcaaaggaagttcaggagtat
tatgcagaaaatctgccagggattcctctgtactggaagaatgatataaccccatacaac
aagaagattactggctggtactcaaatccactgtatgggatcatgaatgaattcaccttc
accggtgtaaaatcctctgcctga

DBGET integrated database retrieval system