KEGG   Methanospirillum hungatei: Mhun_0245Help
Entry
Mhun_0245         CDS       T00325                                 

Definition
(GenBank) ribosomal RNA adenine dimethylase
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_12 Methyltransf_23 Methyltransf_11 GidB MTS CMAS PCMT Methyltransf_4 Cons_hypoth95 DUF938 DREV PrmA Met_10 Methyltransf_32 Methyltr_RsmB-F MIase
Motif
Other DBs
NCBI-ProteinID: ABD40017
JGI: Mhun0245
UniProt: Q2FUE5
Position
complement(270813..271649)
Genome map
AA seq 278 aa AA seqDB search
MIDWAHIWKEQYEAGSRLKEVGDCASLWNSKERALEFLNMSRENPERIEQVLSRLPITHE
SRILDIGAGPGTLAFPFAERAAHVTAIEPSPGMIEVMKDQIAELQVHNLTIVPKRWEDVD
PSSDLTERFDIIVASYSLGMPDISAAIDKMLAVSSGQIWLFWFAGTTPWERHMERLWPDI
HNESYSHGPKSDVLYNVLYQKGIYPNMTVHEMKYEKKYQSMDDAVYEMRRQIGCSDNYDP
LIKEYLKDKIYMNGQSFIENGMTTRVCMWWDSNQYPKK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatagactgggctcacatatggaaagaacagtatgaagcagggagcagactcaaagaa
gtcggagactgtgcctctctttggaattcaaaagagcgtgcccttgaatttctgaatatg
tcacgggaaaaccctgaacggatagagcaggtattatcacgacttccgataacccatgaa
agccgaattcttgatatcggtgcaggtcccggaacacttgcctttccgtttgcagaacgg
gcagcacatgtcactgccatagaaccgtctcccggaatgattgaagtcatgaaggaccag
attgctgaattacaggtacataatcttactattgttccaaaacgatgggaggatgtcgat
ccttcttcagatcttacggaaagatttgacatcattgttgcatcgtactctcttggaatg
cccgatattagtgctgccattgacaaaatgctcgctgtttcttctggccagatatggctt
ttctggtttgcaggaacaacaccctgggaacggcacatggaacggttatggccggatata
cataacgaatcttactcacatggtccgaaatctgatgttttgtataatgtgctgtatcaa
aaagggatttacccgaatatgacggtgcatgagatgaaatatgagaaaaagtatcaatcc
atggacgatgcagtctatgaaatgaggcggcagattgggtgttctgataattatgatcct
cttatcaaagaatatctcaaggataaaatttacatgaacggacagtctttcatcgaaaat
ggcatgaccacacgggtatgtatgtggtgggattcgaatcagtaccccaaaaaatga

DBGET integrated database retrieval system