KEGG   Methanospirillum hungatei: Mhun_0262Help
Entry
Mhun_0262         CDS       T00325                                 

Definition
(GenBank) transposase, IS4 family
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ABD40034
JGI: Mhun0262
UniProt: Q2FLR9
Position
complement(288129..289721)
Genome map
AA seq 530 aa AA seqDB search
MQVKKRIKKINGIEYWYEDTPYYDKEKKQIRHKSKYLGKNIDGQPVKVRTSEMIPARMVV
SSAPKFAYNHGNLLPLQSITQELSIQATLEEFLSESETDTLLTLVYNRILRPTAMTNVQV
WYEGSSLWLNNNKLPLSSQRISEFLANLGQKNIPEEFMRRFAAQIEPNATLLYDITSLSS
SSKLLESLEYGYNRDNDGLPQINFSLVVDKEKGIPVRYDIYPGSIADITTLKNTIIRLRD
AGSEQFRLVMDRGFFSQTTLAELLSENIPFILPATYQLTSIKELMSKSQNKVKQAEYLQK
LEKGPIFAMPVKLEHQLEIDDKPRTITVDGYCYYDPKREQDERDSFYVQLFDAADRLKKA
RPQSWKRPEVVVNEIAKGFARYLKWKFTDGTFEVSIRQKAVTQRINRLGRFILFYNGELD
WLSCLTLYRERDAVEKCFLRMKNDLDTLPLNARREDTVRGYLFMVFIALIIRMRLQMILK
ETGLSKQYSVEKLLLELEKIKLFVLSQGEIIQSEVSKKNREILTALSLCA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttaaaaaacgtatcaaaaaaattaatgggattgagtactggtacgaagatact
ccttactatgataaagaaaaaaagcagatccggcataaatcaaagtacctcggaaaaaac
atagatgggcaacctgttaaggttcgaacgagtgaaatgattcctgcacgaatggtagtt
tcttctgccccaaaattcgcatataatcacgggaatctgctaccacttcaaagtattacc
caagagctttcaatacaggcaacactggaagaatttctttcagaatcagaaacggataca
ttattaactctcgtttacaaccgaattcttcgcccaacggcgatgacaaatgttcaggtg
tggtatgaaggatcttcactatggctaaataacaataaattgcctctatctagccaaaga
ataagtgaattcttggcaaaccttggtcaaaaaaacatccctgaagagtttatgagacga
ttcgctgctcaaattgaaccaaatgcaactcttctctatgacattaccagtttatccagt
tcatctaaacttttagagagcctagaatatggatacaatcgggataatgatggccttcct
cagattaatttttcactggtagtggataaggaaaaaggtattcccgtccgttatgatata
tatccaggaagtattgccgacatcactacgttgaaaaataccatcatacgattgagagat
gctggttcagaacaatttagactagtaatggatagaggtttcttttcccaaaccacattg
gctgaacttttgagcgagaatatcccttttattctgcctgcgacctatcaactcacgtca
attaaagaattaatgagtaaatctcaaaataaggtaaaacaagctgaatatcttcagaaa
ttggagaaaggtcctatatttgcaatgccagtgaaattagagcatcaattagagatcgat
gataaacctcgaacaattactgttgatggctattgctattatgacccaaaaagagaacag
gatgaaagagattctttttatgtacaattattcgacgcggctgatagattgaagaaagca
agaccacaaagttggaaaagacctgaagtagtggtgaatgaaatcgcgaaagggtttgca
cgttacctgaaatggaaatttacagacggaacattcgaggtttcaataagacagaaagca
gttactcaaagaataaatcgcctaggacgatttattcttttttacaacggcgaattagac
tggctttcctgtctcaccctttatcgtgagagagatgcagttgagaagtgtttcttaaga
atgaagaacgatttggacactttacctcttaatgcaagaagagaagatacggtgaggggt
tatttgttcatggtttttatagcccttatcattagaatgagattacaaatgattttgaag
gaaacgggcctttcaaaacaatattctgtcgaaaaactacttctcgaacttgaaaagatc
aaactttttgtactatctcagggagagattattcaatctgaagtcagtaagaaaaataga
gaaattttgactgcattaagtctatgcgcctaa

DBGET integrated database retrieval system