KEGG   Methanospirillum hungatei: Mhun_0268Help
Entry
Mhun_0268         CDS       T00325                                 

Definition
(GenBank) Protein of unknown function DUF1628
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pilin_N
Motif
Other DBs
NCBI-ProteinID: ABD40039
JGI: Mhun0268
UniProt: Q2FPF4
Position
complement(297368..298006)
Genome map
AA seq 212 aa AA seqDB search
MKINKGRTDPAVSPVIGVLLMLVVTIIVAAVVSGFAGGLAGDAKAAPSVSMDVKIDTSAS
NGMGGTTSQMTFEMLSGDPIPTKDLEIITYFTNSTGHIYKTSHSATSEKFDLYGYGTSYT
RLPYLNDISKVGYAGNNDKADFGNYTISTGDILSAGSTRQVAEFLGLDWTAGTDPDPDTI
DDADFKPGATVQVNILHTPSQKTIYSKEVVVK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaataaaggcagaacggatccggcagtatcgcctgtgatcggtgttctgtta
atgcttgtggtgacgattatcgttgctgctgtggtgagtgggtttgccggggggctggcc
ggagatgccaaggcagctccatcggtgtccatggatgtaaagattgatacatctgcaagt
aatgggatgggaggaacaacaagccaaatgacattcgaaatgctgagtggagatcctata
cccaccaaagatcttgaaattattacctactttaccaatagcacgggtcatatttacaag
acttctcactccgccaccagtgaaaaatttgatttatatggatatggaacaagttataca
cggttaccatatctcaatgacatttcaaaggttggatatgctggaaataatgataaagca
gattttggtaactacaccatttcaactggtgacatcctttctgcaggatctacccggcag
gttgcagaattcctcggccttgattggactgcagggacggatccggatcctgatactatt
gatgatgcggactttaaaccaggggcaaccgttcaggtaaacattcttcatactcccagt
caaaaaactatctattccaaggaggttgtggtaaaatga

DBGET integrated database retrieval system