KEGG   Methanospirillum hungatei: Mhun_0276Help
Entry
Mhun_0276         CDS       T00325                                 

Definition
magnesium chelatase, ChlI subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhun_0276
Enzymes [BR:mhu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mhun_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307216..309075
Genome map
AA seq 619 aa AA seqDB search
MFHEHEYFADIKGLNEAKLSLLLFLVSPVIRSLILIGGTGTGKSHLARLTKSVTDVKTVH
LPQHATWDRVFGSIDITASLARGEKVIEHGLLKKADGGIVIMDDIHLMDHTLITAVLSAA
ETGMVKIERDGISSGYQTNFKIIATLNQDEGEISPHIIDRFSLCALCPAITDPLLRKQFL
EKAIIRNPGNFIPDSKSSEKENQQREQILQAQHRYPYVQIPDGIMDLITSLATDLGVEGH
RGDIAHSSAASALAALNERDQVSVDDISATLQVSLQHRRRDYQKEPQSSHDTDKNKSSPP
EPENKKDGDGLPQDNRHEEGDQNESQQKQIPQAPAPDQVFTIGDIQFTKDLIVQKKNKNF
HSMVKTGKKGSHQKISDSGRYFRSKNPSGKIYDIAFDATFRAAAPHQITRSNGTLALNIS
VQDIRVKERKRKSGRTIIFVVDSSGSMGAAKRMSAVKGAVLSLLKDAYINRDQVALISFR
GPGAEVLLKPTRSGMTAYHQLAHLPTGGQTPLSSGIYTTVSLIRTIRRKNSHDEPFVIII
SDGRANHARSDNDPVAEAWMAAAAARNEKAHYYVIDTECGYPRFFLAKKLAEHIGGTYTL
LDTMNGEEIVQLVRQERGR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatgagcacgagtattttgctgatattaaaggacttaatgaagcaaaattatca
cttcttctcttcctggtatcaccagttatcaggagtctgattcttattggtgggaccggt
actggtaaatctcatcttgccaggctgaccaaatcagtaacagatgtgaaaaccgtacat
ctccctcaacatgcaacatgggaccgggtttttggctcaattgatatcacggcctcatta
gcacggggagaaaaagtaattgagcacggacttttaaaaaaggctgatggaggtattgtt
atcatggatgatattcatctcatggatcatactctcataaccgcagttctctctgcagca
gaaaccggaatggtgaaaattgaaagagatggaatatcatcaggatatcagacaaatttt
aaaataatcgcgaccctgaatcaggatgaaggggaaatctctccacatataattgatcgg
ttttccctctgtgctctatgcccggcaataaccgatccactgctccggaagcagtttctt
gaaaaagccataataagaaatcctggtaattttattcccgattctaaatcctctgaaaaa
gaaaatcaacaaagagaacagattttacaagcccaacaccggtacccatatgtccaaatt
ccggatgggataatggatctgatcaccagccttgctacagacctgggagttgagggtcat
cgtggtgatattgctcattccagcgcagcatctgcccttgcagcgttgaacgaacgagat
caggtttcggttgatgatatttcagcaactctccaggtatctctccaacaccgaagacga
gattaccagaaagagccacaatcttcacatgataccgataaaaataaatcatctccaccg
gaacccgagaataaaaaggacggcgatggattgccacaggataaccggcacgaagaaggg
gatcagaatgagtcacagcaaaaacaaatcccacaagctcctgctccggatcaggtcttt
acaataggcgatatacaattcacaaaagatctcatagttcaaaagaaaaacaaaaatttc
cattcaatggttaaaaccgggaaaaagggatcacatcagaaaatatctgatagcgggaga
tatttccggtcaaaaaatccttcaggaaaaatctacgatatcgcgtttgatgcgactttc
cgtgcagcggcaccacaccagattacccgatcaaatggaacgctcgccttgaatatatcc
gtacaggacattcgtgtaaaagaacggaaacgaaaatccgggcgtactataatctttgtt
gtcgattcaagtggttccatgggtgctgcaaaacgaatgagtgcagtcaagggagcagtc
ctctcattattgaaagatgcatatatcaaccgagaccaggtggctctcatttcattcagg
gggccgggagcagaagttctgttaaaacccacccgaagtggaatgactgcgtatcatcag
ctggcgcatcttccaaccggaggacaaacccccttatcctctggaatttacactacagta
agcctcatcagaactatcagacggaaaaattctcatgatgaaccgtttgtcataattatc
tctgatggcagggccaatcatgcacgatctgataatgatccggttgcagaagcatggatg
gctgcggcggctgcgagaaatgagaaagcacattactatgtcatagatactgaatgtggc
tacccccggtttttcctggcaaaaaaacttgctgaacatatcgggggaacatataccctg
cttgatacgatgaacggagaagaaatcgttcagcttgtcagacaggagaggggtcgttaa

DBGET integrated database retrieval system