KEGG   Methanospirillum hungatei: Mhun_0279Help
Entry
Mhun_0279         CDS       T00325                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02010  ABC transporters
Module
mhu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mhun_0279
Enzymes [BR:mhu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Mhun_0279
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Mhun_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 Mg_chelatase SMC_N AAA_15 AAA_23 AAA_22 AAA_16 RsgA_GTPase AAA_33 NACHT NB-ARC AAA_30 AAA_27 AAA_18 T2SSE AAA_5 MMR_HSR1 AAA_24 AAA ATPase_2
Motif
Other DBs
NCBI-ProteinID: ABD40050
JGI: Mhun0279
UniProt: Q2FLM8
Position
311416..312435
Genome map
AA seq 339 aa AA seqDB search
MGLIKIDKLTIGYKKRKNGERKVISHLNLDMKSGELICLVGPNGSGKSTLLKTITGLLPP
LDGEVFLSGRNIRSISSLERAKLVSMVLTNPVQAGQLTVYDVCSLGRYPHTDWMGSLAQE
DHDMITASLDAIGIRHFAHRYLHELSDGERQKVMIARALAQNSKLIILDEPTAFLDMPYR
IEIMHILKNLAMNEDRGILLSTHDLDLAMRTADRLWVVNHDGSFHDGAPEDLVLNGIISQ
VFAIGEISYDAERGHFHMPVHPKGSARITGENGKFRFWTERAMERIGYISQENEPAEIHV
HIAPTESCITWIIKTPGTVKKFSNLTDGIHWIQTLKLVV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggggcttataaaaatagacaaacttaccatcggatacaaaaaaagaaagaatggagag
agaaaagtcatctctcatcttaacctggatatgaaatccggtgagttaatatgtcttgta
ggtccgaacggcagtggaaaatcaactcttttaaaaacaattactggccttctgccgccg
ttagacggtgaggtttttctttcgggcaggaatataagatcgatatcatctctggaacgg
gctaaactggtatctatggtactaacaaatccggtacaggctggacaactgacggtatat
gatgtgtgcagtctgggaaggtatccacataccgactggatgggatcattggcacaggaa
gaccatgatatgataaccgcatctctggatgctattggaatcagacattttgcacaccgg
tatttacatgaactgtcagatggcgaacgacaaaaggtgatgattgcccgggctcttgca
caaaattcaaaactcataattctggatgaacctactgcctttcttgatatgccctaccgg
atagaaataatgcacattctcaaaaatcttgccatgaacgaagatcggggaattctcctt
tcaacacatgatctggatctcgcaatgcgaaccgcagatcgtctctgggtcgtcaatcat
gatggttcttttcatgatggtgctcctgaggatttggttttaaatggaattatttcacag
gtgtttgcaattggtgaaatctcctatgatgctgagcggggacattttcatatgcctgtc
catcctaagggatcagcccggataactggagagaatgggaaattcagattctggacagaa
agagccatggaaaggattggatatatctcacaggaaaatgaaccggcagagattcatgta
catatcgctcccacagaaagttgtataacgtggatcattaagactcccggtacagtgaaa
aaattttccaacctgactgatggaatacattggatacaaaccttaaagctagttgtttaa

DBGET integrated database retrieval system