KEGG   Methanospirillum hungatei: Mhun_0291Help
Entry
Mhun_0291         CDS       T00325                                 

Definition
magnesium chelatase, ChlI subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(327001..329043)
Genome map
AA seq 680 aa AA seqDB search
MSHHHKKPLIPFTAIIGQDQMKKALVLNAINPTIGGVLIRGEKGTAKSTAVRSLAEILPM
ITVVPGCPFSCDPKKESEFCELCAEKKKQKSLPNPKDQQIRVVNLPVGATEDRVVGTIDI
ERALKEGIKALEPGILADANRGILYIDEVNLLDDHVVDVLLDAAAMGVNTVEREGISFSH
PSRFILIGTMNPEEGELRPQLLDRFGLQVSVEALDNPDERMAIVKTSEEFLKDPDTFRQK
FKRKQKDIAKKIRKAIKILPSVTISDDLVRKAVDVCIGLGVRTHRAEITIVRTAKTIAAF
DGRKTVNQDDLREAIELALPHRMRRRPFEEPKVDPEKLDDLMNEPSQNQENQQDNPPDQP
PSDQQESKGQNQQSEPENRTDPSASQGNAPKEQQVFRIGSPIDPDKIKSPDRRTVEKRYA
PGRRFDTNGGDRRGQYIGAEKRPTGRDIALDATIRAVSPYQKMRLSDSLAIVIRSDEVLQ
KKRIGKTATATLFVVDASGSMGVEQRMEAAKGAIFSLLEDSYQNRDRVGLVAFRGEGADV
VLPLTSSIDLAYQRLSELPTGGKTPLAAGLQKSLTILMREKQKYPSLLPLLVLITDGRAN
VGNGGKLKDEIGLITDDLVKAGIETVIIDTESKQKGRLSIQLGFCPFIAQRTQGRYFQIS
DLTASDLSSAVVSGMKTSLA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcatcataaaaaaccgcttattccatttactgctattatcggccaggaccag
atgaaaaaagccctggtcctgaatgctatcaacccgaccatcggaggtgtccttatccgg
ggtgagaaggggactgcaaaatcaaccgcggtccggtctcttgccgaaatacttcccatg
ataacggtagttcccgggtgcccgttctcctgtgatccgaaaaaagaatctgaattttgt
gaactctgtgcagaaaaaaagaaacaaaaatctctgccaaatccaaaagaccagcagata
cgggtggtgaatttaccggtcggggcaaccgaggatcgggttgtcggcacgatagacatt
gagcgggcattaaaggaaggaattaaagcacttgaacctggaatactcgctgatgcaaat
cgcggaattctgtatattgatgaagtaaaccttcttgatgatcatgtcgttgatgtgctt
cttgatgcagccgccatgggggtgaacacggttgaacgtgaaggaatatcattttcacac
ccctcacggtttattctcatcggcacaatgaaccctgaggagggagaactgagaccccag
ttactagaccggttcggactccaggtatcggttgaggcacttgataatccggatgaacga
atggcgatcgtcaagacatctgaagagtttttaaaagatccggataccttccgtcagaaa
ttcaaaagaaagcagaaagatatcgcaaaaaagattcggaaagcgataaaaatcctcccc
agtgtaacgatttcagatgatctggtgcgaaaagcagtggatgtgtgcattggccttggg
gtacgaacacaccgggccgagatcaccattgtcaggacagcgaagaccatagcagcattt
gatggtcggaagaccgtaaaccaggacgaccttcgggaggctattgaacttgcccttccc
caccggatgagaagaagaccgtttgaggagccaaaagttgatccggaaaagcttgatgac
ctgatgaacgaaccttcccaaaatcaggagaatcagcaggacaaccctccggatcaaccc
ccatctgatcaacaggaatccaagggacaaaaccagcaatctgaaccagaaaacagaaca
gatccatcagcttcacaagggaacgctccaaaggaacagcaggtgttccggattggatcg
cccatagatccggataagataaaatcaccggaccgaagaacggttgaaaaacgatacgcc
ccggggcgacggtttgatacgaacggaggagaccggcgtggtcagtatatcggtgcggaa
aaaagaccaaccggacgtgacatcgcccttgatgccacaatccgggccgtttccccgtat
cagaagatgcgtctgtcagactcattggccatagttatccgttcagatgaagtccttcag
aagaaacggataggaaaaacggccactgccaccctctttgtcgtggatgcaagtggttcg
atgggggttgaacagcggatggaggcagcaaaaggggctattttctccctgcttgaagat
tcctaccagaaccgggatcgtgtcggccttgttgcattccggggtgaaggagcagatgtg
gttctgccccttacatccagcatagatcttgcataccagcgcttatctgaactgccaacc
ggtggaaaaaccccgcttgcagccggattgcaaaaatcccttacaatactcatgcgggag
aaacaaaagtatccatcattacttcccctactcgttcttattaccgatggacgggcgaat
gtcggaaatggaggaaaactgaaagatgagattggattaattaccgatgacctggtaaaa
gccggaattgaaaccgtcattatcgataccgaatcaaaacagaaaggacggttaagtatt
caacttggattctgtcctttcattgcacagcggacacagggacgatacttccagatctca
gatctgactgcttcagatctatccagtgcagtagtatcaggaatgaaaacatccttggct
tga

DBGET integrated database retrieval system