KEGG   Methanospirillum hungatei: Mhun_0291Help
Entry
Mhun_0291         CDS       T00325                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00860  Porphyrin and chlorophyll metabolism
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhun_0291
Enzymes [BR:mhu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mhun_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA Mg_chelatase AAA_5 MCM AAA_16 AAA AAA_3 Sigma54_activat Mg_chelatase_C VWA_CoxE AAA_22
Motif
Other DBs
NCBI-ProteinID: ABD40062
JGI: Mhun0291
UniProt: Q2FMX9
Position
complement(327001..329043)
Genome map
AA seq 680 aa AA seqDB search
MSHHHKKPLIPFTAIIGQDQMKKALVLNAINPTIGGVLIRGEKGTAKSTAVRSLAEILPM
ITVVPGCPFSCDPKKESEFCELCAEKKKQKSLPNPKDQQIRVVNLPVGATEDRVVGTIDI
ERALKEGIKALEPGILADANRGILYIDEVNLLDDHVVDVLLDAAAMGVNTVEREGISFSH
PSRFILIGTMNPEEGELRPQLLDRFGLQVSVEALDNPDERMAIVKTSEEFLKDPDTFRQK
FKRKQKDIAKKIRKAIKILPSVTISDDLVRKAVDVCIGLGVRTHRAEITIVRTAKTIAAF
DGRKTVNQDDLREAIELALPHRMRRRPFEEPKVDPEKLDDLMNEPSQNQENQQDNPPDQP
PSDQQESKGQNQQSEPENRTDPSASQGNAPKEQQVFRIGSPIDPDKIKSPDRRTVEKRYA
PGRRFDTNGGDRRGQYIGAEKRPTGRDIALDATIRAVSPYQKMRLSDSLAIVIRSDEVLQ
KKRIGKTATATLFVVDASGSMGVEQRMEAAKGAIFSLLEDSYQNRDRVGLVAFRGEGADV
VLPLTSSIDLAYQRLSELPTGGKTPLAAGLQKSLTILMREKQKYPSLLPLLVLITDGRAN
VGNGGKLKDEIGLITDDLVKAGIETVIIDTESKQKGRLSIQLGFCPFIAQRTQGRYFQIS
DLTASDLSSAVVSGMKTSLA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcatcataaaaaaccgcttattccatttactgctattatcggccaggaccag
atgaaaaaagccctggtcctgaatgctatcaacccgaccatcggaggtgtccttatccgg
ggtgagaaggggactgcaaaatcaaccgcggtccggtctcttgccgaaatacttcccatg
ataacggtagttcccgggtgcccgttctcctgtgatccgaaaaaagaatctgaattttgt
gaactctgtgcagaaaaaaagaaacaaaaatctctgccaaatccaaaagaccagcagata
cgggtggtgaatttaccggtcggggcaaccgaggatcgggttgtcggcacgatagacatt
gagcgggcattaaaggaaggaattaaagcacttgaacctggaatactcgctgatgcaaat
cgcggaattctgtatattgatgaagtaaaccttcttgatgatcatgtcgttgatgtgctt
cttgatgcagccgccatgggggtgaacacggttgaacgtgaaggaatatcattttcacac
ccctcacggtttattctcatcggcacaatgaaccctgaggagggagaactgagaccccag
ttactagaccggttcggactccaggtatcggttgaggcacttgataatccggatgaacga
atggcgatcgtcaagacatctgaagagtttttaaaagatccggataccttccgtcagaaa
ttcaaaagaaagcagaaagatatcgcaaaaaagattcggaaagcgataaaaatcctcccc
agtgtaacgatttcagatgatctggtgcgaaaagcagtggatgtgtgcattggccttggg
gtacgaacacaccgggccgagatcaccattgtcaggacagcgaagaccatagcagcattt
gatggtcggaagaccgtaaaccaggacgaccttcgggaggctattgaacttgcccttccc
caccggatgagaagaagaccgtttgaggagccaaaagttgatccggaaaagcttgatgac
ctgatgaacgaaccttcccaaaatcaggagaatcagcaggacaaccctccggatcaaccc
ccatctgatcaacaggaatccaagggacaaaaccagcaatctgaaccagaaaacagaaca
gatccatcagcttcacaagggaacgctccaaaggaacagcaggtgttccggattggatcg
cccatagatccggataagataaaatcaccggaccgaagaacggttgaaaaacgatacgcc
ccggggcgacggtttgatacgaacggaggagaccggcgtggtcagtatatcggtgcggaa
aaaagaccaaccggacgtgacatcgcccttgatgccacaatccgggccgtttccccgtat
cagaagatgcgtctgtcagactcattggccatagttatccgttcagatgaagtccttcag
aagaaacggataggaaaaacggccactgccaccctctttgtcgtggatgcaagtggttcg
atgggggttgaacagcggatggaggcagcaaaaggggctattttctccctgcttgaagat
tcctaccagaaccgggatcgtgtcggccttgttgcattccggggtgaaggagcagatgtg
gttctgccccttacatccagcatagatcttgcataccagcgcttatctgaactgccaacc
ggtggaaaaaccccgcttgcagccggattgcaaaaatcccttacaatactcatgcgggag
aaacaaaagtatccatcattacttcccctactcgttcttattaccgatggacgggcgaat
gtcggaaatggaggaaaactgaaagatgagattggattaattaccgatgacctggtaaaa
gccggaattgaaaccgtcattatcgataccgaatcaaaacagaaaggacggttaagtatt
caacttggattctgtcctttcattgcacagcggacacagggacgatacttccagatctca
gatctgactgcttcagatctatccagtgcagtagtatcaggaatgaaaacatccttggct
tga

DBGET integrated database retrieval system