KEGG   Methanospirillum hungatei: Mhun_0450Help
Entry
Mhun_0450         CDS       T00325                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit gamma, pyruvate/2-ketoisovalerate
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_0450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_0450
   00020 Citrate cycle (TCA cycle)
    Mhun_0450
   00620 Pyruvate metabolism
    Mhun_0450
   00640 Propanoate metabolism
    Mhun_0450
   00650 Butanoate metabolism
    Mhun_0450
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_0450
   00680 Methane metabolism
    Mhun_0450
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhun_0450
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhun_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
522859..523401
Genome map
AA seq 180 aa AA seqDB search
MRELRIHGRGGQGSVTAAELIAVAAFKSGVFSQAFPAFGVERRGAPVQAFVRFSDEKIRL
RSQVYEPDYVIVQDSTLIKDVNVFSGMKKGGIILINTGGDIHGTIPEGVRYIPIDATKLA
LEVLGVPITNTTLMGAFAAASGEISLEALEEAVRERFSGSLADKNVAASRKAYDLIKGGA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgagagagttgaggatccatgggagaggtggtcaggggtcggtcactgcagccgaactg
atcgccgttgcagcctttaagagcggagtattttcacaagcctttccggcatttggagtc
gaaaggcggggtgcaccggtccaggcttttgtcaggttctcggatgaaaagatccggctc
agaagccaggtatatgaaccggactacgttattgtacaggacagcaccctgatcaaggat
gtaaatgtcttctccggcatgaagaaggggggcattatcctcattaataccggtggagat
attcatggcaccataccggaaggtgtcaggtatattccgatcgatgcaactaaacttgca
cttgaggttcttggtgtaccaattacaaacaccactttgatgggagcgtttgctgcagcc
tccggggagataagtctggaagcactggaagaggcagtccgagaacggttctccggcagt
ctggcagataagaatgtggctgccagccggaaggcatatgatctgatcaagggaggtgca
taa

DBGET integrated database retrieval system