KEGG   Methanospirillum hungatei: Mhun_0453Help
Entry
Mhun_0453         CDS       T00325                                 

Definition
(RefSeq) thiamine pyrophosphate enzyme-like TPP-binding
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_0453
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_0453
   00020 Citrate cycle (TCA cycle)
    Mhun_0453
   00620 Pyruvate metabolism
    Mhun_0453
   00640 Propanoate metabolism
    Mhun_0453
   00650 Butanoate metabolism
    Mhun_0453
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_0453
   00680 Methane metabolism
    Mhun_0453
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhun_0453
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhun_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
524824..525711
Genome map
AA seq 295 aa AA seqDB search
MADRTLELVDSGHRACGGCGPAFAARLILKGAGERSIVCASTGCMEVFSTPYPQTAWKVP
WIHSLFQNAAAVASGVEAALKRQGRDEHVLCICGDGATFDIGVLCISGAFERGHNITYIC
YDNEAYMNTGIQRSGATPFDASTTTSPAGKKSFGNSRPKKDMPQILAAHGAPYVATCSIA
YPNDVIKKVERAVNTDGPCYIQIHTPCCTGWGFDGSKTIDIGKLAIETGLWVNYEIVNGK
IEKAKKVKRKPVEEYLRVQKRFAHLFKPSVNTEEIAKIQAIADANAEKFGIDLKI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagaaccttagaactggtagattcagggcaccgggcctgtggtggctgtggt
cctgcatttgcagccagattaattctcaaaggagccggggagcgatccatcgtctgtgct
tcaaccggatgtatggaagtcttttcaactccctatcctcagacggcatggaaagtcccc
tggattcactctctcttccagaatgctgcagcggttgcatccggtgttgaggctgcctta
aagcggcagggtcgggatgagcatgtcctgtgtatctgtggagatggtgcaacctttgat
attggtgtcctctgtatcagcggagcctttgaacgaggccataatatcacctatatctgc
tatgataacgaggcatacatgaacaccggtatccagcggtctggtgcaacaccctttgat
gccagtaccaccacttctccagccggaaagaagagctttggaaattccaggccaaagaag
gatatgcctcagattcttgccgcacatggggccccgtatgtcgcaacctgttcgattgca
tacccgaatgatgtcatcaagaaggtagaacgggcagtgaacactgacgggccgtgctat
attcagatccacaccccatgctgtaccggctggggatttgacggatcaaagaccatcgac
attgggaaactggcaatcgagaccggtctctgggtcaattatgagatcgtgaatgggaag
attgagaaggccaagaaggtcaaacgaaaaccggtcgaagagtatcttcgtgttcagaaa
cgatttgctcatctctttaaaccctccgtcaatactgaagagattgcaaaaatccaggca
atagccgatgcaaatgcagaaaaattcggtattgatctgaagatctaa

DBGET integrated database retrieval system