KEGG   Methanospirillum hungatei: Mhun_0552Help
Entry
Mhun_0552         CDS       T00325                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhu  Methanospirillum hungatei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mhun_0552
Enzymes [BR:mhu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mhun_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(637314..638807)
Genome map
AA seq 497 aa AA seqDB search
MKTRGSGILLHITSLPGQFGIGDLGPQADRFVDFLQASGQRYWQILPVHPTDIRYDNSPY
HSISAFAGNPLLISPEEMVNDGYLDPSDLQEGLEGPRDEVDYKAVIAYKERLFDMAYNRF
AYFGSDPRFIDFCSEQAWWLDDYALFTAIRKYYAPAVWSDWPHPLKERDPQALHEFQEKN
NSVIEREKFIQYIFSGQWEALRKKCHNAGIRLIGDIPIYIDYDSSDVWTYSDLFRLDKER
RPTFVAGVPPDYFSATGQVWNNPLYDWDAIKNSGFSWWLLRLKRELSMVDYVRIDHFRGL
VGFWEIRAGSDTAIEGRWIEAPAWDFIRTLVKEFPCLPIIAEDLGIITSDVREIMREFMI
PGMKVLVFAFSSPTGDNPYILHNIPKDSVVYTGTHDNTPVRGWYELDATHEEKQRLIAYL
GREPEIHEISDIFIRLAMMSSANTAIIPIQDILGLDSSARMNKPGTEHGNWRWRLQERMI
SEELSRRLSELVKIYGR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccgcgggagtggcattcttcttcacatcacttcacttcccggtcagttcggg
attggcgatctggggcctcaggcagatcggtttgttgattttttacaggcatcaggacag
cggtactggcagatccttccggtccatccaaccgatatcaggtatgataactccccgtac
cattctatctctgcttttgcaggtaatcctctcctcatcagtcctgaggagatggtcaat
gacggctatcttgatccttcagatctgcaggagggtttggagggacctcgtgatgaagta
gattataaagccgtcattgcatataaggaacggctctttgatatggcgtataaccggttt
gcgtatttcggatcagacccccggtttatcgacttttgtagtgaacaggcatggtggctt
gatgattacgctctttttaccgcaatcagaaaatattatgccccggctgtctggtcagac
tggcctcatccattgaaagagagggatccccaggcacttcatgagtttcaggagaagaat
aattcagtaattgaacgtgagaagttcattcagtatatcttctccggccaatgggaggca
ctcaggaaaaaatgccataatgccggtattcgacttatcggtgatattcccatctatatc
gattacgatagcagtgatgtctggacctattcggatctcttccggttggataaagaaagg
aggccaacattcgttgcaggtgtccctccggattatttcagtgcaaccgggcaggtatgg
aataatccactctatgactgggatgccataaagaattccgggttttcctggtggctttta
cgactgaagagagaactctccatggttgattatgtacggatcgatcatttcagggggctt
gttggattctgggagatcagagcaggatcagataccgcaatcgaaggaaggtggatagag
gctcctgcctgggatttcatcaggaccctggtgaaagaatttccctgcctcccgattatt
gcggaggatctgggcattatcacatctgatgtcagagagattatgagagagtttatgatt
ccgggaatgaaagtcctggtctttgccttcagttccccaaccggggataacccgtacatt
cttcataatatccccaaagattcggttgtgtataccgggacccatgataatacaccggtc
aggggatggtatgaactggatgcaactcatgaagaaaaacaaaggcttattgcatacctc
ggaagggagcccgaaattcatgagatatctgatatattcatccgtctagcgatgatgagc
agtgccaatactgcaatcatacctatacaggatattctgggacttgattcatctgcaaga
atgaataaaccaggtactgaacacgggaactggagatggcggttacaggagaggatgata
tcagaagaactctccaggcggctctcagaactggtaaaaatttacggaagatga

DBGET integrated database retrieval system