KEGG   Methanospirillum hungatei: Mhun_0556Help
Entry
Mhun_0556         CDS       T00325                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_0556
   01230 Biosynthesis of amino acids
    Mhun_0556
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_0556
   00030 Pentose phosphate pathway
    Mhun_0556
   00051 Fructose and mannose metabolism
    Mhun_0556
   00052 Galactose metabolism
    Mhun_0556
  Energy metabolism
   00680 Methane metabolism
    Mhun_0556
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhun_0556
Protein phosphatases and associated proteins [BR:mhu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mhun_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
644521..645510
Genome map
AA seq 329 aa AA seqDB search
MNGKIPGSSRIGILTSGGDAPGMNAAIRAVYRAAHELGIEVVGIRRGFSGLIEGDFFLMD
RSHVANIIHLGGTVLGTSRSEEFKTSEGRKKSAENLRNAEIDALLVIGGEGSFRGADLFN
DETGIPTIGIPGSIDNDIPGTDFSIGFDTAINTALEAIDKIRDTAISHGRLFFVEVMGRS
SDLIAIESGIAGGAEYLVLPGDHDAIMDLCARLTDAFSAGKRYAIVVVAEGERPGCSFEI
SKKVSEQIDIESRVVVLGHIQRGGSPTARDRVLAAKLGVSAVYAYTKSHAGVMVGELRRS
VVLTPFDKVITGRQKPEPNIIRLAHILTK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaaattcccgggtcatcacgaatagggattcttacatctggtggcgatgct
cctggtatgaatgcagcaatcagggctgtataccgtgccgcacatgaactgggtattgaa
gtagtcggaatcaggagaggattttccgggctgattgaaggggattttttcctaatggac
agatcgcatgtggcaaatattatccacctgggtggcactgtccttggaacttcgagatct
gaagagtttaagacgagtgaaggacggaaaaaatctgcagaaaatcttaggaatgctgaa
atagatgccctccttgtcataggcggtgaaggttcattcagaggtgccgacctcttcaat
gatgagactggtatcccgactatcggcattccgggctctatcgataatgatattccaggg
actgacttttctatcgggtttgataccgccataaatactgcccttgaagcgattgataag
atacgggatacggcaatatctcatgggcggttattttttgttgaagtgatgggaaggtct
tcagatctcatcgccatcgagagcggcattgccggtggagctgagtacctggttctccca
ggggatcatgatgccattatggatctctgtgccaggctgactgatgcgttttcagcagga
aagcgatacgccatcgtagttgttgcggaaggtgagagaccgggttgcagttttgagata
tcaaaaaaggtatcagagcagatagatattgagtcgcgggtggtggttctgggtcatatt
cagcggggaggaagtccgaccgcacgggatcgggtcctggctgctaaactcggggtaagt
gctgtctacgcatatacaaaaagtcatgccggggtgatggttggtgaactgagacggagc
gtggttcttaccccctttgataaggtaatcaccggacgacagaaaccagaaccgaatatt
atccgcctggcccacattctgacaaaataa

DBGET integrated database retrieval system