KEGG   Methanospirillum hungatei: Mhun_0592Help
Entry
Mhun_0592         CDS       T00325                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_0592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_0592
   00620 Pyruvate metabolism
    Mhun_0592
   00640 Propanoate metabolism
    Mhun_0592
  Energy metabolism
   00680 Methane metabolism
    Mhun_0592
Enzymes [BR:mhu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mhun_0592
Lipid biosynthesis proteins [BR:mhu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mhun_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(677448..679115)
Genome map
AA seq 555 aa AA seqDB search
MKHEIPHQMTSYDEFVETFRIDVPEFYNFGFDVIDKWAETDRNKLAMIWVSQDGQEKKYT
FRDLRNLSVEAANILIKYGVKKGDRVMLMLHRIPEWWIFVIALIKLGAVFCPAPTMLTSK
DLQYRINAGKFEFIITDTENADKVEKICRFCPTLKHRMLIDGELPNWISYQYELFYPAPV
SRSAISMPITQKTHASDPMLIYFTSGTTGEPKMVLHNHSHPLGHIVTARLWQDLNSNDLH
FTSSDTGWAKCGWGKIFGQWIIGACVFVYDARGKFKATELLPLIEKYEISTFCCPPTIYR
MLIIADLAKYDLRSLRHCISAGEPLNPEVIRIWQEETGLPIYEGYGQSETCCCVATFPCM
VHKPGSMGKPSPGWKIELHDEDGNPVPQGTEGRIAINLNPRPVGLFVEYLDNPEANADVF
KNGFYYTGDKAYMDEDGYFWFVGRDDDVIKSSGYRIGPFEVESALQEHPSVQESAVVGSP
DPIRGMVIKAFIVLKAGYEPSDQLIRDIQKHVKKVTAPYKYPRIIEFVEELPKTLSGKIK
RGELRERELRRYQES
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgagatccctcatcagatgacatcatatgatgaatttgttgaaacgttcagg
attgatgtgcctgagttctataatttcggatttgatgtcatagacaaatgggcagagacc
gaccggaacaaattggcaatgatttgggtaagccaggatggtcaggagaagaaatatacc
ttccgggatctccggaatctctcggttgaagcggcaaatattcttataaaatacggagtt
aaaaagggtgaccgagtgatgctcatgctccaccggatccctgaatggtggatctttgtc
atcgccctaatcaaactaggtgcagtcttctgtcctgccccgaccatgctgacatcaaag
gatctgcaataccggattaatgcaggtaaatttgaatttattattactgacaccgagaat
gcagacaaggttgaaaagatctgcaggttctgcccgacattaaagcaccggatgctgatt
gatggtgaactgccaaactggatcagttatcagtatgaactcttttacccggccccggtc
tccaggtctgcaatcagcatgccgataacccaaaagacacatgcatctgacccgatgctc
atctactttacttcagggacgaccggtgagccgaagatggtgctccataaccactcgcac
ccgctcgggcatattgtcacggcacgtctctggcaggacttgaacagtaatgacctgcac
tttacctcatcagataccggctgggcaaagtgcggatggggtaagatattcggtcagtgg
ataataggggcctgtgtatttgtttacgatgccagagggaaattcaaggcgaccgagctg
cttccgcttattgaaaaatatgagatctcaacgttctgttgcccgccgactatctaccgg
atgcttatcatcgccgaccttgcaaaatatgatctccgctctctccgccactgtatttca
gcaggggaacccttaaatcctgaagtcatcagaatctggcaggaagagaccggtcttcca
atttatgaaggatatgggcagagtgaaacctgctgctgtgttgccactttcccatgtatg
gtgcataaaccaggatccatgggtaaaccatcgccaggctggaagattgaactgcatgat
gaagatggaaacccagtcccccaggggactgaagggcggatagcgatcaatctcaacccc
cggccggtcggtctctttgttgaatacctggataatccggaagcaaatgcagatgtgttt
aagaacggattttactacaccggcgataaggcctacatggacgaggacggttatttctgg
ttcgttggcagggatgatgacgttatcaagagttcaggatatcgtatcggtccatttgag
gtagagagcgctcttcaggagcacccgtctgttcaggaatccgcggtggtcggctctccg
gatcccatccggggtatggtcattaaggcttttatcgttctgaaggcaggatatgaacca
tcagaccagcttatccgcgatattcagaagcatgtcaaaaaagtgacggctccgtacaag
tatccccgtatcattgagtttgtagaggaacttccaaaaacgctctctgggaaaattaaa
cgaggagaactgagagagagggaacttcggagatatcaggagtcgtaa

DBGET integrated database retrieval system