KEGG   Methanospirillum hungatei: Mhun_0808Help
Entry
Mhun_0808         CDS       T00325                                 

Definition
pseudouridylate synthase (EC:4.2.1.70)
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
mhu  Methanospirillum hungatei
Brite
Enzymes [BR:mhu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     Mhun_0808
Transfer RNA biogenesis [BR:mhu03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Mhun_0808
 Prokaryotic Type
    Mhun_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(918441..919709)
Genome map
AA seq 422 aa AA seqDB search
MMESPWDIDRELGLHYYLTESPGTGGVLRDLPDDFEVQEIADHTYSDGPYLICSLNRRNW
DQHRAIKAIASGLGISHQRIGFAGTKDKRAVTTQFISIYKIKAEEIARLSIPDITLTALG
TSQHPIKLGDLQGNSFAIRIRKISDSSLLTSLESFQKSIKEGIPNYVGYQRFGVSRPVTH
LIGFEILKGNYQEAVRVMIGKPGSQMEDHEQEGRACYLETEDAARCLHLLPPRLSLERSV
LHHLVRYPGDYLGAILQLPRTLRSMYVSAVQSWIFNTTLSMRIRDGHSLFEPEVGDYLIW
PDGRTDKITPATIHAAKVQLKRGTCALALVLPGGSYISDAGPDDRNIHTVLEEKGISSQM
FEKVSSVLDTKFAGSFRPMLMKTDLTYEIIDGDLLVRFSLPPGQYATTILRELMKADPMD
MV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaagtccctgggatattgatagggaacttggtctccattactatctgactgaa
tcgcccggcaccgggggagtactaagagatctgcctgatgattttgaagttcaagaaatt
gcagaccatacgtattccgacgggccgtatcttatctgttcactgaaccggaggaactgg
gatcaacaccgtgcaataaaagcgatagcatccggacttgggatcagtcatcagcggatt
ggatttgcagggacgaaggataaacgggctgttaccacacaatttatctcgatttataag
atcaaggcagaagagatagcacggctttcaattcccgatattaccttgaccgcccttgga
acatcacaacatccgataaaacttggagatctccaaggtaacagttttgctattcgtatc
aggaagatatctgattcatcgttattaacttccctggaaagctttcagaaatcgatcaag
gaaggtataccaaattatgtaggttatcagcggtttggtgtctcacgaccggtcacacac
cttatcggatttgagatactgaaagggaattaccaggaagccgtcagggtgatgattgga
aaaccaggctcgcagatggaggatcatgaacaggaaggaagagcttgttatctagaaact
gaagatgctgcccggtgtctccatcttctccctccccggttatcactggaacgttcagtt
ctacatcatctggtacgttatccgggagattacctgggtgccatcctgcaactccccagg
acccttcgttctatgtatgtgagtgcggtgcagtcatggatttttaatactacgttgagc
atgcgtatccgggatggtcattcattattcgaaccggaagttggggattatcttatctgg
cctgatggaaggactgataaaatcacaccggcgaccatccatgcagcgaaggttcagctt
aaaagaggtacatgtgccctcgcactggttctccccggaggatcgtatatttctgatgcc
ggacctgatgacagaaatatccacactgttctcgaagagaagggtatttcaagtcagatg
tttgagaaggtatcatctgttcttgatacaaaatttgccggatcatttcgtcccatgctg
atgaaaacagatctgacatatgagattattgatggagatcttcttgtcaggttctctctg
cctcccggtcagtatgctacaactatccttcgtgaactcatgaaagcagatccaatggat
atggtttga

DBGET integrated database retrieval system