KEGG   Methanospirillum hungatei: Mhun_0887Help
Entry
Mhun_0887         CDS       T00325                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mhu  Methanospirillum hungatei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mhun_0887
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mhun_0887
Enzymes [BR:mhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mhun_0887
Two-component system [BR:mhu02022]
 CheA family
  CheA-CheYBV
   Mhun_0887
Bacterial motility proteins [BR:mhu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mhun_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
993127..993675
Genome map
AA seq 182 aa AA seqDB search
MKIIIIGSSTGGPYILESIFSDFPVVNAAIVIVQHLPPTFTRTLANHISSLIKMPVSVAS
EGEELAAPHIYIAPAGSHLLIKNNRTFALNNSEKLHGVRPAVDLTMLSMQKKTDDSIMGI
VLTGMGRDGADGIYFLHTLGAITIAQDPATAPIKSMPQAAIETGGVDFILTPEKIKHAII
QF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatcataatcggttcatctacaggcggcccgtatatactggaatcaattttc
tctgattttccagttgtgaatgcagccattgttatcgtacagcatctccctccgaccttt
acccggactttagccaaccatatctcatcacttataaaaatgccggtttctgtcgcgagt
gaaggagaggaactggcagcgccacatatctacattgctcctgccggatcccatcttctg
ataaaaaataatagaacctttgccctcaataatagtgagaaactacatggtgtccgccca
gctgttgatttgaccatgctgtcaatgcagaaaaaaactgatgattctatcatgggcatt
gtactgaccggtatgggacgagatggtgctgatggtatatattttctgcatacattaggt
gcgattaccattgcacaggacccggcaactgcacccattaaaagtatgccacaggcggca
atagagactggaggagttgattttattctgactccggaaaaaattaagcatgctatcatt
cagttttaa

DBGET integrated database retrieval system