KEGG   Methanospirillum hungatei: Mhun_0891Help
Entry
Mhun_0891         CDS       T00325                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhu  Methanospirillum hungatei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mhun_0891
Enzymes [BR:mhu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mhun_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
996880..997467
Genome map
AA seq 195 aa AA seqDB search
MIARIRGLVIGYETGSVIVEAGGIGYRIRVPESVLTSITKDDEIILYTELIIRQDLMQLY
GFYTPEETEMFRLLISVSHIGPQTGLAIISRLSLPEICDAISSKKPEILSQVQGLGKKGA
ERIILELQKKVSELKIQYPQTPTSSTKIQDAVLALLSLGYSREEAMGALERSALDTETVS
SSELVREALVFLRKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacgaatcaggggtctggttatcggatatgaaacaggatcggtcattgttgag
gcaggggggattggttatcgcatccgtgtcccggaatcagtccttacctctatcacaaaa
gatgatgagattattctgtatacagaacttatcatccgtcaggatctcatgcagttgtat
ggtttttatactcctgaagagacagagatgttccgccttctcatatcagtatctcacatc
ggcccacagaccggacttgcaattataagcagactatctcttcctgaaatctgtgatgcc
atctcatccaaaaaaccagagatattatcacaggtccagggacttgggaagaagggagca
gaacggatcatcctggagcttcagaaaaaggtatcagaactgaagattcagtatccgcaa
acacccacttcatcaacaaaaatccaggacgccgttcttgcattgttatctctgggatat
agtcgtgaggaagcaatgggagctttagagagatcagcactggatacagaaaccgtatcc
tcatcagaacttgtcagggaagccctcgtattccttcggaaaaagtga

DBGET integrated database retrieval system