KEGG   Methanospirillum hungatei: Mhun_0912Help
Entry
Mhun_0912         CDS       T00325                                 

Definition
(GenBank) peptidase M42
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1016352..1017389
Genome map
AA seq 345 aa AA seqDB search
MVYDLLKKLSDAHGLSGFEGNIKSIIRKELEGYVDEISEDRLGNLIAVKKGTGLSVMIAS
HMDEIGLMVQYIDEKGFIKFVGIGGWFNPTLHTQRVVLHGTRGPVFGVIGSKPPHVMTPE
DRKKEIKMEDMFIDIGASSAEEVAELGIEIGTPVTIEQELIHLANNRITGKALDNRVGVL
VLIETLKKMKTSMTVYAVFTVQEEIGLKGAKVSAFALHPDFAIATDVTIPGDHPGVTKKE
ASVEMGKGPVLVLASASGRGLLADNRLVAWLRSAGDKMKIPYQLEVGDGGNTDASIINLV
RDGIPSIPLSVPSRYIHSPVEVVDLKDIEATIDLLVEALKKKPKI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgatttattaaaaaaactctccgatgcacatggactttcaggatttgaagga
aatatcaaatcaattatccgaaaagaactggagggatatgtcgatgaaatttctgaagac
agacttggaaaccttatcgcagtaaaaaagggcacaggactttcagttatgattgcatcc
catatggatgaaatcggacttatggtccagtatatcgatgaaaaagggtttataaaattt
gtagggatcggaggatggttcaatccgactcttcatacccagagggttgtcctccatggg
acgagagggccggtttttggagtgattggatcgaaacctccacatgtcatgacaccggag
gaccggaaaaaagagatcaagatggaggatatgttcattgatatcggagcatcatcagca
gaagaagttgcagagcttggtattgagataggaactccggtaacgattgaacaggaactc
attcatctggcaaataatcggattaccgggaaagcgttggataatcgggtgggtgttctg
gtcctcattgaaacactgaaaaagatgaagacctcaatgaccgtttatgcagtatttacc
gtacaggaagagatcggtttgaagggggcaaaggtcagtgcgtttgctttacaccctgat
tttgcaattgcaaccgatgttacgattccaggagatcatcctggtgtaaccaaaaaagaa
gcatcggttgagatgggaaaaggaccggtcctggttctggcaagtgcatcagggagaggg
ttactggctgataaccggctggtcgcatggctacgatctgccggagataagatgaaaatc
ccataccagctggaagtaggcgacggaggaaatactgatgcctcgattattaaccttgtc
agggatgggatccccagtatccccttatcagtcccatctcgatacatccattccccggta
gaggtggttgatctcaaggatatcgaggctacgattgacctgcttgttgaagcactaaaa
aagaaaccaaagatctga

DBGET integrated database retrieval system