KEGG   Methanospirillum hungatei: Mhun_0912Help
Entry
Mhun_0912         CDS       T00325                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mhu  Methanospirillum hungatei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mhun_0912
Enzymes [BR:mhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mhun_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1016352..1017389
Genome map
AA seq 345 aa AA seqDB search
MVYDLLKKLSDAHGLSGFEGNIKSIIRKELEGYVDEISEDRLGNLIAVKKGTGLSVMIAS
HMDEIGLMVQYIDEKGFIKFVGIGGWFNPTLHTQRVVLHGTRGPVFGVIGSKPPHVMTPE
DRKKEIKMEDMFIDIGASSAEEVAELGIEIGTPVTIEQELIHLANNRITGKALDNRVGVL
VLIETLKKMKTSMTVYAVFTVQEEIGLKGAKVSAFALHPDFAIATDVTIPGDHPGVTKKE
ASVEMGKGPVLVLASASGRGLLADNRLVAWLRSAGDKMKIPYQLEVGDGGNTDASIINLV
RDGIPSIPLSVPSRYIHSPVEVVDLKDIEATIDLLVEALKKKPKI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgatttattaaaaaaactctccgatgcacatggactttcaggatttgaagga
aatatcaaatcaattatccgaaaagaactggagggatatgtcgatgaaatttctgaagac
agacttggaaaccttatcgcagtaaaaaagggcacaggactttcagttatgattgcatcc
catatggatgaaatcggacttatggtccagtatatcgatgaaaaagggtttataaaattt
gtagggatcggaggatggttcaatccgactcttcatacccagagggttgtcctccatggg
acgagagggccggtttttggagtgattggatcgaaacctccacatgtcatgacaccggag
gaccggaaaaaagagatcaagatggaggatatgttcattgatatcggagcatcatcagca
gaagaagttgcagagcttggtattgagataggaactccggtaacgattgaacaggaactc
attcatctggcaaataatcggattaccgggaaagcgttggataatcgggtgggtgttctg
gtcctcattgaaacactgaaaaagatgaagacctcaatgaccgtttatgcagtatttacc
gtacaggaagagatcggtttgaagggggcaaaggtcagtgcgtttgctttacaccctgat
tttgcaattgcaaccgatgttacgattccaggagatcatcctggtgtaaccaaaaaagaa
gcatcggttgagatgggaaaaggaccggtcctggttctggcaagtgcatcagggagaggg
ttactggctgataaccggctggtcgcatggctacgatctgccggagataagatgaaaatc
ccataccagctggaagtaggcgacggaggaaatactgatgcctcgattattaaccttgtc
agggatgggatccccagtatccccttatcagtcccatctcgatacatccattccccggta
gaggtggttgatctcaaggatatcgaggctacgattgacctgcttgttgaagcactaaaa
aagaaaccaaagatctga

DBGET integrated database retrieval system