KEGG   Methanospirillum hungatei: Mhun_1027Help
Entry
Mhun_1027         CDS       T00325                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_1027
   01230 Biosynthesis of amino acids
    Mhun_1027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1027
   00051 Fructose and mannose metabolism
    Mhun_1027
   00562 Inositol phosphate metabolism
    Mhun_1027
Enzymes [BR:mhu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mhun_1027
Exosome [BR:mhu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mhun_1027
  Exosomal proteins of bladder cancer cells
   Mhun_1027
  Exosomal proteins of melanoma cells
   Mhun_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1156819..1157502)
Genome map
AA seq 227 aa AA seqDB search
MKQQSLKTPLVLVNLKCYTESIGNGAHRIARAAREIMDESGVTIALAPLYTDIHPINHHY
DIPVFAQHVDPVDPGAHTGRMPLAAIKSAGAIGSLVNHSEYRLNVADIEKNVSALKGAGL
LSCVCSNNVATTAALAALNPNYVAIEPPELIGGKISVSEANPDIITDSVDVVRKISPAVK
VLTGAGIHSGKCVKTAVDLGTDGVLLASSVVKAEDPAAVLRDLVSLL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacagtcattgaaaacaccactcgtcctcgttaatctgaagtgttataccgaa
tcaatcggaaacggagctcatcggattgccagggccgcccgtgaaataatggatgaatct
ggggttaccattgcactggcaccattatatacagatattcatcccataaatcatcattat
gatattccggtttttgcccagcatgtagacccggttgatcctggtgcccataccggccga
atgcctctggctgcgatcaaatctgcaggagcaatcggatcactggtaaatcactcagaa
taccggctgaatgttgcagacattgaaaagaatgtcagtgccctgaaaggtgccgggctt
ctctcatgtgtctgctcgaataatgtggcaaccactgctgctcttgctgccctgaatccg
aattatgtggcaattgaaccaccagaacttattggtggaaaaatatctgtatctgaagca
aatccggatattattactgactctgtagatgttgtcagaaaaatcagtcctgcagtaaaa
gttcttaccggtgccggaatccactcaggaaaatgtgtaaagacagcagttgacctggga
acggatggagtcctgctggcatccagtgtggttaaggcagaagatcctgcagcagttctt
cgcgaccttgtttcacttctctga

DBGET integrated database retrieval system