KEGG   Methanospirillum hungatei: Mhun_1027Help
Entry
Mhun_1027         CDS       T00325                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_1027
   01230 Biosynthesis of amino acids
    Mhun_1027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1027
   00051 Fructose and mannose metabolism
    Mhun_1027
   00562 Inositol phosphate metabolism
    Mhun_1027
Enzymes [BR:mhu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mhun_1027
Exosome [BR:mhu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mhun_1027
  Exosomal proteins of bladder cancer cells
   Mhun_1027
  Exosomal proteins of melanoma cells
   Mhun_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1156819..1157502)
Genome map
AA seq 227 aa AA seqDB search
MKQQSLKTPLVLVNLKCYTESIGNGAHRIARAAREIMDESGVTIALAPLYTDIHPINHHY
DIPVFAQHVDPVDPGAHTGRMPLAAIKSAGAIGSLVNHSEYRLNVADIEKNVSALKGAGL
LSCVCSNNVATTAALAALNPNYVAIEPPELIGGKISVSEANPDIITDSVDVVRKISPAVK
VLTGAGIHSGKCVKTAVDLGTDGVLLASSVVKAEDPAAVLRDLVSLL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacagtcattgaaaacaccactcgtcctcgttaatctgaagtgttataccgaa
tcaatcggaaacggagctcatcggattgccagggccgcccgtgaaataatggatgaatct
ggggttaccattgcactggcaccattatatacagatattcatcccataaatcatcattat
gatattccggtttttgcccagcatgtagacccggttgatcctggtgcccataccggccga
atgcctctggctgcgatcaaatctgcaggagcaatcggatcactggtaaatcactcagaa
taccggctgaatgttgcagacattgaaaagaatgtcagtgccctgaaaggtgccgggctt
ctctcatgtgtctgctcgaataatgtggcaaccactgctgctcttgctgccctgaatccg
aattatgtggcaattgaaccaccagaacttattggtggaaaaatatctgtatctgaagca
aatccggatattattactgactctgtagatgttgtcagaaaaatcagtcctgcagtaaaa
gttcttaccggtgccggaatccactcaggaaaatgtgtaaagacagcagttgacctggga
acggatggagtcctgctggcatccagtgtggttaaggcagaagatcctgcagcagttctt
cgcgaccttgtttcacttctctga

DBGET integrated database retrieval system