KEGG   Methanospirillum hungatei: Mhun_1133Help
Entry
Mhun_1133         CDS       T00325                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mhu  Methanospirillum hungatei
Brite
Enzymes [BR:mhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mhun_1133
Transfer RNA biogenesis [BR:mhu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mhun_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1275078..1276646)
Genome map
AA seq 522 aa AA seqDB search
MDITPACREIISLILSTPPGERELRKIVKTICKKYHLPVVPRNSDILSCATPEEYPLLRP
VLLVKPSRTLSGVAPVAVMTSPAPCPHGICLPCPGGPDSLFQSPQSYTGGEPAAKRAFAH
NFIPYDQVHARLSQFEELGHHVDKAELIVMGGTMTAREPSYQEWFVTECIRAMNEYPDNP
LPDTSREEIFARNETAKVRCVAITFETRPDWCRKEHIDRMLDLGVTKVELGVQHLDDEIL
TLNLRGCTVADTVEANTFLRDAGLKVGFHMMPNLPGSTFASDRQMFHDLFADPRFRPDFL
KIYPCLVTPGSKIEELYESGAYAPYDEDDLIDLVADAKMEIAPYCRLQRIQRDIPADKIV
AGSPHSNFRELAKQRLHKRGGRCSCIRCREIGRRRSQAEPVLNILPYECCGGMERFISFE
SDDSLVGFARLRFPKEPWRPETENAAFVRELHVYGMVVPIGQEGRGEDQQHRRFGTRLLS
EAETLAADAGYSHVAIMAGIGVRPYYQKLGYFRKGPYMIKDL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggacatcacccccgcctgccgggagataatctctctcattctctccactcctcccggt
gagcgagaacttcgaaagatagtcaagactatctgcaaaaaatatcatctgccggttgtt
ccccggaactcagatattctatcctgcgctacccctgaggagtatccgctgcttcgtcct
gttcttctggtaaaaccatcacgaactctgtctggtgtggccccggtcgcggtcatgaca
tcaccggccccctgtccgcatggtatctgtcttccctgtccgggtggcccggattcgctt
tttcaatctccccagagttataccggtggcgaacctgccgcaaaacgtgcctttgcacac
aatttcatcccctatgatcaggtgcatgcacgattatcccagtttgaggagctcgggcat
cacgtggataaggctgaactcatcgtcatgggagggaccatgaccgcccgggagccatca
taccaggaatggtttgtgaccgaatgcatcagggcaatgaatgaatacccagataacccg
ttacccgacaccagccgggaggagatatttgccagaaatgaaaccgccaaagtacggtgt
gtggcgataacctttgaaacccggccagactggtgccggaaggagcatattgaccggatg
cttgatcttggcgtgacaaaggtggagcttggggtccagcaccttgacgacgaaatcctg
accctgaacctgaggggatgcaccgttgcagataccgtggaagcaaatacctttcttcgt
gatgccggtctcaaagtcgggtttcacatgatgcccaatctcccaggaagcaccttcgca
tctgaccggcagatgttccatgatctctttgcggatccacgattcagacctgattttctg
aaaatatatccgtgccttgtgacaccgggatcaaagatcgaagagctctatgaatcgggg
gcttatgcaccatatgatgaagacgacctcatcgatctggtggccgatgcaaagatggag
atagcaccatattgccggcttcagcgaatccagcgggacattcctgcagataagatcgtg
gcagggtctcctcattcaaacttccgggaactggccaaacaacgtctgcacaagagaggt
ggcaggtgctcatgtatcaggtgcagggagataggcaggagacgatcacaggctgagccg
gtcctgaatattctgccctatgagtgctgcgggggtatggaacggtttatctcatttgaa
tctgatgactcgctggtcggattcgcacggctgcggttccccaaagaaccctggcgaccg
gagactgagaatgctgcgtttgtccgtgaacttcatgtctatgggatggtggtcccgatc
gggcaggaaggaagaggtgaggatcagcaacacagacggttcgggacacgacttctctct
gaagcagagacgctcgcagcggatgccggatacagccatgttgcgatcatggcagggatc
ggggtcagaccctactatcagaaacttgggtatttcaggaaaggcccctatatgattaag
gatctgtga

DBGET integrated database retrieval system