KEGG   Methanospirillum hungatei: Mhun_1465Help
Entry
Mhun_1465         CDS       T00325                                 

Definition
phosphofructokinase, pyrophosphate dependent (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_1465
   01230 Biosynthesis of amino acids
    Mhun_1465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1465
   00030 Pentose phosphate pathway
    Mhun_1465
   00051 Fructose and mannose metabolism
    Mhun_1465
   00052 Galactose metabolism
    Mhun_1465
  Energy metabolism
   00680 Methane metabolism
    Mhun_1465
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mhun_1465
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhun_1465
Protein phosphatases and associated proteins [BR:mhu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mhun_1465
Messenger RNA biogenesis [BR:mhu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mhun_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1687238..1688284)
Genome map
AA seq 348 aa AA seqDB search
MADTTRKIKTIGILTGGGDCPGLNAVIRAVVKTAHLYDYSVIGIRNGWKGIVEGEVEPLT
EFSVTGILPKGGTILGTSRTNPLKSEEQTQQMLSNLKRFGIDAVVAVGGDDTLSVATRLH
QMNIPVVGIPKTIDNDLSGTDYTFGFDTAVSIVTDAIDRLHTTAESHHRIMVLEVMGRHA
GWIATIAGIAGGADQILIPEVPFDIDDVCEGLKKRRERGKKFSIVVIAEGAKPTDMNNFV
TASSKVDEFGHEQLGGIGHLLGRAIEERVGSETRVTVLGHVQRGGSPTAHDRVLATRYGV
KAVQQIHEGNYGVMVALHGDKIVPIPLSDAITQKKVDPELYEMARIFY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctgatactactcggaagataaaaacaatcgggattctgaccggcggtggcgactgt
cccggtctgaacgcagtcattcgtgcagtggtaaagactgcacatctctatgactattcg
gttatcgggattcggaatggatggaagggtattgtagaaggggaagtagagcccctgaca
gaattttccgtaaccggtattctgccgaagggggggactatccttgggacatcacggacc
aatcccctgaagagtgaggagcagacccagcaaatgctctcaaatctgaagcggttcggg
attgatgccgtcgtcgccgtcggcggggatgacacgctcagtgttgcaacccggctgcac
cagatgaatatccctgtggtgggcatcccaaagacgatagataatgacctctccggaacc
gactataccttcggatttgatactgcggtatccattgtaaccgatgccatagaccggctc
cataccactgccgaatcccatcaccgcatcatggtacttgaagtgatgggacgtcatgca
ggctggattgcaacgattgccgggatagcaggtggagcagatcagatcctgattcctgaa
gtgccctttgatattgacgatgtctgtgagggcctgaagaaacggcgggaacggggtaag
aagttctccattgtggtcatcgccgagggggctaaacccaccgatatgaataactttgta
acggcctcttcaaaagtggacgagttcgggcatgaacagctgggtggtattggtcatctg
cttggcagggccattgaagagcgggtcggttcagaaacccgtgtcaccgttcttggtcat
gtgcagcggggtgggtcgccgaccgcccatgaccgtgttctggcaaccaggtacggggtt
aaagcagttcagcagattcatgaggggaattatggcgtaatggtcgctctccatggggac
aagatagttccgattcctctaagcgatgccattacccagaagaaggttgatcctgaactc
tatgagatggccaggatcttttactaa

DBGET integrated database retrieval system