KEGG   Methanospirillum hungatei: Mhun_1465Help
Entry
Mhun_1465         CDS       T00325                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00010  Glycolysis / Gluconeogenesis
mhu00030  Pentose phosphate pathway
mhu00051  Fructose and mannose metabolism
mhu00052  Galactose metabolism
mhu00680  Methane metabolism
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01120  Microbial metabolism in diverse environments
mhu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1465
   00030 Pentose phosphate pathway
    Mhun_1465
   00051 Fructose and mannose metabolism
    Mhun_1465
   00052 Galactose metabolism
    Mhun_1465
  Energy metabolism
   00680 Methane metabolism
    Mhun_1465
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhun_1465
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Mhun_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DUF128 Peripla_BP_1 Peripla_BP_4 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABD41199
JGI: Mhun1465
UniProt: Q2FP89
Position
complement(1687238..1688284)
Genome map
AA seq 348 aa AA seqDB search
MADTTRKIKTIGILTGGGDCPGLNAVIRAVVKTAHLYDYSVIGIRNGWKGIVEGEVEPLT
EFSVTGILPKGGTILGTSRTNPLKSEEQTQQMLSNLKRFGIDAVVAVGGDDTLSVATRLH
QMNIPVVGIPKTIDNDLSGTDYTFGFDTAVSIVTDAIDRLHTTAESHHRIMVLEVMGRHA
GWIATIAGIAGGADQILIPEVPFDIDDVCEGLKKRRERGKKFSIVVIAEGAKPTDMNNFV
TASSKVDEFGHEQLGGIGHLLGRAIEERVGSETRVTVLGHVQRGGSPTAHDRVLATRYGV
KAVQQIHEGNYGVMVALHGDKIVPIPLSDAITQKKVDPELYEMARIFY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctgatactactcggaagataaaaacaatcgggattctgaccggcggtggcgactgt
cccggtctgaacgcagtcattcgtgcagtggtaaagactgcacatctctatgactattcg
gttatcgggattcggaatggatggaagggtattgtagaaggggaagtagagcccctgaca
gaattttccgtaaccggtattctgccgaagggggggactatccttgggacatcacggacc
aatcccctgaagagtgaggagcagacccagcaaatgctctcaaatctgaagcggttcggg
attgatgccgtcgtcgccgtcggcggggatgacacgctcagtgttgcaacccggctgcac
cagatgaatatccctgtggtgggcatcccaaagacgatagataatgacctctccggaacc
gactataccttcggatttgatactgcggtatccattgtaaccgatgccatagaccggctc
cataccactgccgaatcccatcaccgcatcatggtacttgaagtgatgggacgtcatgca
ggctggattgcaacgattgccgggatagcaggtggagcagatcagatcctgattcctgaa
gtgccctttgatattgacgatgtctgtgagggcctgaagaaacggcgggaacggggtaag
aagttctccattgtggtcatcgccgagggggctaaacccaccgatatgaataactttgta
acggcctcttcaaaagtggacgagttcgggcatgaacagctgggtggtattggtcatctg
cttggcagggccattgaagagcgggtcggttcagaaacccgtgtcaccgttcttggtcat
gtgcagcggggtgggtcgccgaccgcccatgaccgtgttctggcaaccaggtacggggtt
aaagcagttcagcagattcatgaggggaattatggcgtaatggtcgctctccatggggac
aagatagttccgattcctctaagcgatgccattacccagaagaaggttgatcctgaactc
tatgagatggccaggatcttttactaa

DBGET integrated database retrieval system