KEGG   Methanospirillum hungatei: Mhun_1465Help
Entry
Mhun_1465         CDS       T00325                                 

Definition
phosphofructokinase, pyrophosphate dependent (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mhu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mhu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mhu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mhu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1687238..1688284)
Genome map
AA seq 348 aa AA seqDB search
MADTTRKIKTIGILTGGGDCPGLNAVIRAVVKTAHLYDYSVIGIRNGWKGIVEGEVEPLT
EFSVTGILPKGGTILGTSRTNPLKSEEQTQQMLSNLKRFGIDAVVAVGGDDTLSVATRLH
QMNIPVVGIPKTIDNDLSGTDYTFGFDTAVSIVTDAIDRLHTTAESHHRIMVLEVMGRHA
GWIATIAGIAGGADQILIPEVPFDIDDVCEGLKKRRERGKKFSIVVIAEGAKPTDMNNFV
TASSKVDEFGHEQLGGIGHLLGRAIEERVGSETRVTVLGHVQRGGSPTAHDRVLATRYGV
KAVQQIHEGNYGVMVALHGDKIVPIPLSDAITQKKVDPELYEMARIFY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctgatactactcggaagataaaaacaatcgggattctgaccggcggtggcgactgt
cccggtctgaacgcagtcattcgtgcagtggtaaagactgcacatctctatgactattcg
gttatcgggattcggaatggatggaagggtattgtagaaggggaagtagagcccctgaca
gaattttccgtaaccggtattctgccgaagggggggactatccttgggacatcacggacc
aatcccctgaagagtgaggagcagacccagcaaatgctctcaaatctgaagcggttcggg
attgatgccgtcgtcgccgtcggcggggatgacacgctcagtgttgcaacccggctgcac
cagatgaatatccctgtggtgggcatcccaaagacgatagataatgacctctccggaacc
gactataccttcggatttgatactgcggtatccattgtaaccgatgccatagaccggctc
cataccactgccgaatcccatcaccgcatcatggtacttgaagtgatgggacgtcatgca
ggctggattgcaacgattgccgggatagcaggtggagcagatcagatcctgattcctgaa
gtgccctttgatattgacgatgtctgtgagggcctgaagaaacggcgggaacggggtaag
aagttctccattgtggtcatcgccgagggggctaaacccaccgatatgaataactttgta
acggcctcttcaaaagtggacgagttcgggcatgaacagctgggtggtattggtcatctg
cttggcagggccattgaagagcgggtcggttcagaaacccgtgtcaccgttcttggtcat
gtgcagcggggtgggtcgccgaccgcccatgaccgtgttctggcaaccaggtacggggtt
aaagcagttcagcagattcatgaggggaattatggcgtaatggtcgctctccatggggac
aagatagttccgattcctctaagcgatgccattacccagaagaaggttgatcctgaactc
tatgagatggccaggatcttttactaa

DBGET integrated database retrieval system