KEGG   Methanospirillum hungatei: Mhun_1466Help
Entry
Mhun_1466         CDS       T00325                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_1466
   01230 Biosynthesis of amino acids
    Mhun_1466
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1466
   00030 Pentose phosphate pathway
    Mhun_1466
   00051 Fructose and mannose metabolism
    Mhun_1466
  Energy metabolism
   00680 Methane metabolism
    Mhun_1466
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1466
Enzymes [BR:mhu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mhun_1466
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mhun_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1688277..1689185)
Genome map
AA seq 302 aa AA seqDB search
MSKGFAVPLDVPKSEQDTYIRNLKTITHDSGRLMLFAGDQKIEHLNDDFYGEGIHPDDHD
PEHLFRIAAKAKIGCFATQLGLIAKYGADYPKIPYLIKINSKTHLVPTAQHEPFSNLINT
IDQVVAFRKCSKLNILGIGYTIYLGSEYESAMLSAAAQAIFEAHQNGLVTVLWIYPRGKA
VGNEKDPHLIAGAAGVAACLGSDFVKVNPPKGEGASSAELIREATLAAGRTKVVCAGGSS
VDAATFLTQLWEQIHVGGCSGNATGRNIHQKPLDEAVRMCNAIYAITVDGASVEDAIKIY
HG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggctttgctgttcctctggacgtaccaaaaagtgagcaggacacgtatatt
cgtaatctgaagacgataactcacgattccggtcggctgatgctttttgccggtgaccag
aagattgagcatctgaatgatgacttctatggcgaggggattcaccctgatgaccatgat
cctgaacacctcttcagaatagcagcgaaggcaaaaatcgggtgctttgcaactcagctg
ggacttatcgcaaaatatggtgcagactatcccaagatcccgtacctgattaagatcaat
tccaagacccacttggtaccgacagcacaacatgaacccttctctaatcttatcaacacc
attgaccaggttgttgcattcagaaaatgcagtaaactgaacatcctgggtatcgggtac
accatttacctgggttctgaatatgagtcggcgatgctcagtgctgctgcacaggccatc
tttgaagcacaccagaatggtcttgtcacggtcctctggatctatccacggggtaaagcg
gtagggaatgagaaagatccccaccttatcgccggagcagcaggggttgccgcatgtctt
ggatcagactttgtgaaagttaacccgccgaaaggagaaggtgcatcatctgcagaactt
atccgggaagcaacccttgctgcaggacggacaaaggttgtttgtgcaggcggatccagt
gttgatgctgccacgttcctgacccaactctgggaacagatccatgtcggaggatgcagc
gggaatgcaaccggcagaaatatccatcagaaaccacttgatgaagcggttcggatgtgc
aatgccatctacgccataaccgtggatggggccagtgtggaagatgcgatcaagatttat
catggctga

DBGET integrated database retrieval system