KEGG   Methanospirillum hungatei: Mhun_1466Help
Entry
Mhun_1466         CDS       T00325                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00010  Glycolysis / Gluconeogenesis
mhu00030  Pentose phosphate pathway
mhu00051  Fructose and mannose metabolism
mhu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mhu00680  Methane metabolism
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01120  Microbial metabolism in diverse environments
mhu01130  Biosynthesis of antibiotics
mhu01200  Carbon metabolism
mhu01230  Biosynthesis of amino acids
Module
mhu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1466
   00030 Pentose phosphate pathway
    Mhun_1466
   00051 Fructose and mannose metabolism
    Mhun_1466
  Energy metabolism
   00680 Methane metabolism
    Mhun_1466
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1466
Enzymes [BR:mhu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mhun_1466
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mhun_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ABD41200
JGI: Mhun1466
UniProt: Q2FP88
Position
complement(1688277..1689185)
Genome map
AA seq 302 aa AA seqDB search
MSKGFAVPLDVPKSEQDTYIRNLKTITHDSGRLMLFAGDQKIEHLNDDFYGEGIHPDDHD
PEHLFRIAAKAKIGCFATQLGLIAKYGADYPKIPYLIKINSKTHLVPTAQHEPFSNLINT
IDQVVAFRKCSKLNILGIGYTIYLGSEYESAMLSAAAQAIFEAHQNGLVTVLWIYPRGKA
VGNEKDPHLIAGAAGVAACLGSDFVKVNPPKGEGASSAELIREATLAAGRTKVVCAGGSS
VDAATFLTQLWEQIHVGGCSGNATGRNIHQKPLDEAVRMCNAIYAITVDGASVEDAIKIY
HG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggctttgctgttcctctggacgtaccaaaaagtgagcaggacacgtatatt
cgtaatctgaagacgataactcacgattccggtcggctgatgctttttgccggtgaccag
aagattgagcatctgaatgatgacttctatggcgaggggattcaccctgatgaccatgat
cctgaacacctcttcagaatagcagcgaaggcaaaaatcgggtgctttgcaactcagctg
ggacttatcgcaaaatatggtgcagactatcccaagatcccgtacctgattaagatcaat
tccaagacccacttggtaccgacagcacaacatgaacccttctctaatcttatcaacacc
attgaccaggttgttgcattcagaaaatgcagtaaactgaacatcctgggtatcgggtac
accatttacctgggttctgaatatgagtcggcgatgctcagtgctgctgcacaggccatc
tttgaagcacaccagaatggtcttgtcacggtcctctggatctatccacggggtaaagcg
gtagggaatgagaaagatccccaccttatcgccggagcagcaggggttgccgcatgtctt
ggatcagactttgtgaaagttaacccgccgaaaggagaaggtgcatcatctgcagaactt
atccgggaagcaacccttgctgcaggacggacaaaggttgtttgtgcaggcggatccagt
gttgatgctgccacgttcctgacccaactctgggaacagatccatgtcggaggatgcagc
gggaatgcaaccggcagaaatatccatcagaaaccacttgatgaagcggttcggatgtgc
aatgccatctacgccataaccgtggatggggccagtgtggaagatgcgatcaagatttat
catggctga

DBGET integrated database retrieval system