KEGG   Methanospirillum hungatei: Mhun_1619Help
Entry
Mhun_1619         CDS       T00325                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhun_1619
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhun_1619
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mhun_1619
Enzymes [BR:mhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mhun_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1840034..1841242
Genome map
AA seq 402 aa AA seqDB search
MFDLVCIGCGATYQSDAVIYTCKKCGHLLEVRYDLANINITRKDWQKRPISVWRYRELLP
VAGEPVTLQEGGTPLYHLKRIGDELGIKELYAKHEGMNPSGSFKDRGMTVGVSMALQLGM
KSVACASTGNTSASLAVYGAKAGIPVIVLLPSGKVALGKVAQALMHGAKVISINGNFDRA
LEMVRDLCETKGIYLLNSVNPYRLEGQKTIGFEAIDQLNGEVPDRMVLPVGNAGNISAVY
KGLIELSELGFIDKMPMMTGIQAEGSQPVVRAIKENLPEVIPEGSPETVATAIRIGAPVN
AEKVLHAIRMSKGTADYVTDAEILAMQRDLAQKEGIGVEPASAASVAGVKKLVEAGVIDH
DERIVCVVTGHLLKDPETVIKQCAPPIECGATLESLLSALQL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatctcgtgtgcatcggttgtggtgcaacataccagtctgatgccgttatatac
acctgcaaaaagtgcggacaccttcttgaggtcaggtatgaccttgccaatatcaatatt
accaggaaggactggcaaaaacgcccgatttcggtctggagatatcgtgaactgcttccc
gtagctggtgaaccggttaccctgcaggaaggaggaactcccctgtaccatctcaagcgt
atcggagatgaacttggcattaaggagttgtatgcaaagcacgaagggatgaatccctcc
ggatcatttaaggaccggggaatgaccgtcggcgtttctatggctcttcagctggggatg
aaatcagtggcctgcgcaagtaccggaaatacatccgcatcacttgcagtatatggggct
aaagcaggtatcccggtcatcgtcctgctcccgtcaggaaaagtggctcttggaaaggtt
gcccaggcactcatgcatggggcaaaagtcatctccatcaatggaaactttgacagggca
ctggagatggtccgtgacctgtgtgaaacaaaaggcatctacctgctcaattcagtcaac
ccctaccgtcttgaagggcagaagaccatcggatttgaagccatcgatcaactcaacggt
gaggtccctgaccgaatggttctgccggttgggaatgccgggaacatttctgccgtctat
aaagggcttattgaactttcagaactcgggtttattgacaagatgccaatgatgaccggt
atccaggcagagggttcccaaccggtcgtgagggcaattaaagagaacctgcctgaagtc
attccggaaggatcacctgaaaccgtagcaaccgccattcgtatcggtgccccggtcaac
gcagagaaggtccttcatgcgatccggatgagcaagggaaccgcggattatgtcaccgat
gcagagattctggccatgcagcgtgatcttgctcaaaaagagggtattggtgttgaacct
gcatctgcggcatcagtagccggtgtcaagaaactggtcgaggctggggtcattgatcat
gacgagcgtatcgtatgcgtggtcactggtcacctgctcaaggatcctgaaacggtaatt
aaacaatgtgctccaccaatcgaatgcggcgctacactcgaatcactgctttctgcctta
cagctctga

DBGET integrated database retrieval system