KEGG   Methanospirillum hungatei: Mhun_1721Help
Entry
Mhun_1721         CDS       T00325                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_1721
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_1721
   00620 Pyruvate metabolism
    Mhun_1721
   00640 Propanoate metabolism
    Mhun_1721
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_1721
   00680 Methane metabolism
    Mhun_1721
Enzymes [BR:mhu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mhun_1721
Lipid biosynthesis proteins [BR:mhu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mhun_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1939169..1941058)
Genome map
AA seq 629 aa AA seqDB search
MSEDFEVILHTKSYLPDPEYKAQSHLGDYHNAYQEFLKNPEGFWDRMAREIEWMKPWDKV
LEWDYPYARWFSGGTLNITTSCLDRHIKAGRRNKLALIWRGEDGEERVYTYRQLHRDVMR
FANALKRLGVKKGDRICFYMPLVPEHIIALLACARIGAVHSIVYAGFGAEALHARIRDAE
AKVVITADVGKRRGKVISLRSIVDDAIRNTPSVEKVIVLCREKCSVELYSEMEEDFYSLL
DGVETDCPPEEMDAEDPLFILYTSGTTGMPKGIVHTCGGYATGVHYTARYIFDLKENDVL
WCTADTGWITGHSYIVYGPLSAGATVVITETTPDWPDPGIWWSIIEELGVTIFYTAPTAI
RMFMRVGEEWPNKYNLDSLRIIGSVGEPLNPEAFEWYYRVIGKNRIPVLDTWWQTETGMH
MITTPLGEPMKPGFAGLPVPGIEVDVVDKDGNSMPPGQGGLLVIKKPWPSMMRTVYRNDE
RYRKYWNQIRNYYTAGDLAVKDNDGYIMILGRSDDIIIVAGHNLGTAEVESALVEHEAVA
EAAVIGVPDEIKGQAVKAFVILVKGYEPSQKLVSELTYHVRMSIGPIAMPASIEFVDSLP
RTRSGKIMRRILKAKEMNMDLGDTSTLEE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagattttgaggtcattttacatacgaaatcatatctccctgatccggagtac
aaggcccagtcacacctgggcgattatcataatgcctatcaggagtttttgaaaaatccg
gaaggtttctgggaccggatggcaagggagattgaatggatgaaaccctgggacaaggtc
ctggagtgggattatccctatgcccgatggttttctggcgggaccctgaatatcactacc
agttgtcttgaccggcacattaaggccgggagaagaaataaactggccctcatctggcgg
ggtgaggatggcgaagagcgggtgtacacctaccggcagttgcaccgtgatgtcatgcgg
tttgcaaatgctctgaaaaggcttggtgtgaagaaaggagatcgtatctgtttttacatg
ccgctggtccctgagcatatcatcgcactattagcctgtgcccggattggtgcggttcat
tctattgtatatgccgggttcggagccgaagcactccatgcccgtattcgtgatgcagag
gcaaaagtggttatcacggcagatgtcgggaaacgccggggtaaggtcatctcccttcgg
agcatcgttgatgatgccatccggaacacaccaagtgttgagaaggtcatcgtcctctgt
cgggagaaatgttcggtagagttgtactctgagatggaggaggatttttatagccttctt
gatggtgtggagactgactgcccacctgaagagatggatgcagaagatccactctttatc
ctctataccagcgggacaaccgggatgccgaaagggattgtccatacctgtggcgggtat
gcgaccggagttcattataccgcccggtatatcttcgacctgaaggagaatgacgtcctg
tggtgcacggcagataccggctggattaccggacacagttacatcgtttatggccctctc
tctgccggggctacggtggtcattaccgaaacgactcctgactggcctgatcctggcatc
tggtggagtatcatcgaagagcttggcgttacgatattttacacggcaccaacagcaatc
cggatgtttatgcgggtcggggaggaatggccgaataagtacaaccttgactcgctccgg
atcatcggatcagtgggtgagcccctcaacccggaggcatttgagtggtattaccgtgtc
attggaaagaaccggataccagtccttgatacctggtggcagaccgagaccggaatgcac
atgatcacaaccccccttggtgaaccgatgaaaccagggtttgccgggcttccggttccg
gggattgaggttgatgtcgtggacaaagacgggaacagtatgccaccagggcagggtggt
cttctggtcattaaaaaaccctggccgtctatgatgaggaccgtataccggaatgacgaa
cggtatcgcaagtactggaatcagatacgaaattattacaccgcaggagacctggctgtc
aaggataatgacgggtacatcatgatcctgggcaggtctgatgatatcatcatcgtagct
ggtcataatcttgggaccgcagaggtcgaatcagctctggtagagcatgaggcagtagca
gaagcggcggttatcggtgttccggatgagatcaagggccaggcggtaaaggcatttgtc
attctggtcaaggggtatgagccaagtcagaagcttgtgtctgaactgacctatcatgtg
aggatgagtatcgggccgattgccatgccagcctcgatagaatttgtcgattctctcccc
cgcacaagaagcgggaaaattatgcgaagaatcctcaaagcaaaggagatgaacatggat
cttggtgatacctccacgctggaggagtaa

DBGET integrated database retrieval system