KEGG   Methanospirillum hungatei: Mhun_1788Help
Entry
Mhun_1788         CDS       T00325                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01130  Biosynthesis of antibiotics
mhu01230  Biosynthesis of amino acids
Module
mhu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1788
Enzymes [BR:mhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mhun_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF3927
Motif
Other DBs
NCBI-ProteinID: ABD41509
JGI: Mhun1788
UniProt: Q2FKX4
Position
2021312..2022070
Genome map
AA seq 252 aa AA seqDB search
MILDDIVASAHRRASELPGFFQTPSHTPISLKDAIIQKRRTHAHPVIAELKFASPSRGII
RRETKPEDVATELVHGGCCALSVLTEPEYFSGCSATIPAIRDKVTVPILRKDFIVDEQQL
DETRALGADAVLLIAGVLGEETGHFVEATKKRGLEPLLEVHTRQEARMAVDTDAELIGIN
NRDLRTFKTDLSTTKRIAPLIHQAGRTVVSLSGMIWPCDIRFMSHYADGFLIGSSIMSSK
NPGKRVEGLVYA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgatgatatcgtcgcatcagcccaccggcgggcatctgagctccccggcttc
tttcagacaccctctcatacccccatcagtctgaaagatgcaatcattcagaaacggaga
actcatgcacatccggttattgctgaactcaagtttgcgtcaccttcacgggggatcatc
agaagagagacaaagcccgaagatgttgcaactgaactggtgcatggaggttgctgtgct
ctttcggtcctgactgaacctgaatacttttccgggtgttcagcaaccatcccggccatc
agggacaaggtaacggttccaatcctcagaaaggacttcatcgtggatgagcagcaactg
gacgaaaccagggctcttggagcggatgctgtccttctgatcgccggggttcttggagaa
gagaccgggcactttgtcgaagcaacaaaaaaacgcggtcttgaacctctgcttgaagta
cataccagacaggaggcacgaatggcagtcgataccgacgcagaactcatcgggataaat
aaccgcgaccttcggacattcaaaaccgacctgtccaccacaaagcgaattgctcccctg
attcatcaggcaggcagaaccgttgtatctctgagcgggatgatctggccctgtgatatc
aggtttatgagtcattacgcagacgggtttcttatcggatcaagtattatgtcctcaaaa
aatccaggaaaaagagtggagggattggtatacgcataa

DBGET integrated database retrieval system