KEGG   Methanospirillum hungatei: Mhun_1791Help
Entry
Mhun_1791         CDS       T00325                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhun_1791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhun_1791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1791
Enzymes [BR:mhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhun_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023804..2024583
Genome map
AA seq 259 aa AA seqDB search
MNRLKEAFETRTKSLLMTFTVAGDPDFETSLEIIKALENGGADIIELGLPFSDPVADGPV
IQQADQRALASGMNTDRFFDLVREVRKSSDIPLVVLTYTNLILQRDINTFYQDAADAGID
AVVVADLPYEEAGPYITAAETAGVAPVMMVSTTTSPERLSKILTVKSGFIYLVAALGVTG
MRQKTDPVAQKLLADLKNRTDIPIAPGFGISDREQVREWTDAGADAVIVGSALVREIEDS
LVKPDTLIPRITAFVQSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctgaaagaggcatttgaaaccaggacgaaaagccttcttatgaccttcacc
gtcgcaggagatccggactttgaaaccagtcttgagattatcaaggctcttgagaatggt
ggagcggatatcatcgaacttgggcttccgttctcagaccccgttgccgacggcccggtc
attcagcaggcagaccagcgggcacttgcatctgggatgaataccgaccggttctttgac
ctggtcagagaagtccggaagagttctgatatccctcttgtcgtcctgacttacacgaac
ctgatcctgcagcgggatatcaatacattctatcaggatgcagctgatgccggtatcgat
gccgtggttgttgcagacctcccatacgaggaggcaggcccctatattaccgcagcagaa
accgcaggggtagcgccggtcatgatggtcagcacgaccacctcacctgaacggctttca
aaaatcctcaccgtcaagagcggatttatctacctggtagcggctcttggtgtcaccggt
atgaggcagaagaccgacccggttgcgcaaaaactgcttgccgatcttaaaaacaggaca
gacatcccaatagcccccggatttggcatatctgaccgggaacaggtcagggaatggact
gatgcaggagctgatgcggtcatcgtgggttcggccctggtcagagaaatcgaggatagt
cttgtcaaaccagatacgctgatcccccggattacagcatttgtacaatcactcaaataa

DBGET integrated database retrieval system