KEGG   Methanospirillum hungatei: Mhun_1791Help
Entry
Mhun_1791         CDS       T00325                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhun_1791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhun_1791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1791
Enzymes [BR:mhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhun_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2023804..2024583
Genome map
AA seq 259 aa AA seqDB search
MNRLKEAFETRTKSLLMTFTVAGDPDFETSLEIIKALENGGADIIELGLPFSDPVADGPV
IQQADQRALASGMNTDRFFDLVREVRKSSDIPLVVLTYTNLILQRDINTFYQDAADAGID
AVVVADLPYEEAGPYITAAETAGVAPVMMVSTTTSPERLSKILTVKSGFIYLVAALGVTG
MRQKTDPVAQKLLADLKNRTDIPIAPGFGISDREQVREWTDAGADAVIVGSALVREIEDS
LVKPDTLIPRITAFVQSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctgaaagaggcatttgaaaccaggacgaaaagccttcttatgaccttcacc
gtcgcaggagatccggactttgaaaccagtcttgagattatcaaggctcttgagaatggt
ggagcggatatcatcgaacttgggcttccgttctcagaccccgttgccgacggcccggtc
attcagcaggcagaccagcgggcacttgcatctgggatgaataccgaccggttctttgac
ctggtcagagaagtccggaagagttctgatatccctcttgtcgtcctgacttacacgaac
ctgatcctgcagcgggatatcaatacattctatcaggatgcagctgatgccggtatcgat
gccgtggttgttgcagacctcccatacgaggaggcaggcccctatattaccgcagcagaa
accgcaggggtagcgccggtcatgatggtcagcacgaccacctcacctgaacggctttca
aaaatcctcaccgtcaagagcggatttatctacctggtagcggctcttggtgtcaccggt
atgaggcagaagaccgacccggttgcgcaaaaactgcttgccgatcttaaaaacaggaca
gacatcccaatagcccccggatttggcatatctgaccgggaacaggtcagggaatggact
gatgcaggagctgatgcggtcatcgtgggttcggccctggtcagagaaatcgaggatagt
cttgtcaaaccagatacgctgatcccccggattacagcatttgtacaatcactcaaataa

DBGET integrated database retrieval system