KEGG   Methanospirillum hungatei: Mhun_1819Help
Entry
Mhun_1819         CDS       T00325                                 

Definition
hydrogenase membrane subunit (EC:1.6.99.5)
Orthology
K05903  
NADH dehydrogenase (quinone) [EC:1.6.99.5]
Organism
mhu  Methanospirillum hungatei
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mhu00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2055087..2056556)
Genome map
AA seq 489 aa AA seqDB search
MIAVLYPVVAMVILLLQLLLRTHRSLSLLGVIHPVISLIITLYFIVSPGIWDDSPFFLID
HMSLFVMLTTSIIFAAAALYAVGYIDGLVRSGDLEKRSLRIFYFGFSFLLAATTMAIFTP
NIALFWICAELTTVLSAVLIAILALKATIDASLKYIFICSTSMLFSFIGIIFLFEAVRNK
TGVGSLLWTEIVDEAAGLDSGMVFIAFVFFFIGFAAKSGIVPFHTWLPLAHAKAPSAVSA
VLSGAILNIGMYGILRMTGIMKETGVFGQVSVLLIVFAMITISVACLSMLRQKKLKTLIA
FSSIENMGFILLGIGIGSPVALFWALFHMLSHSCIKAGLFFSAGILHRQYKVPTRTGEDE
IGDLLLLQPFAAVTVMAGCAALIGMPLFPLFLSKVGILLAAAAISVWIPAIVLLLFACAG
VALLRFYLPVMAVRFPAGEGPVPYTAPLSMKVPIVLLLLLSIMIGTVMIPGEEAFLAAAV
ADLGFGVQL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagtcctgtacccggtggttgcaatggtgattcttcttttgcagctgctgctc
cggacacaccggtcactcagccttcttggcgttatccatccggttatttccctcataata
acgctgtattttatcgtatctcctgggatctgggacgattccccgttcttcctcatcgat
cacatgagcctttttgtgatgctcacaaccagcatcatctttgctgcagcagctctgtat
gctgttggatatattgacgggctggtcaggtcaggggatctggagaagagaagtcttcgg
atattttatttcggattctcattcctgcttgccgctacaaccatggcaatcttcaccccc
aatattgccctgttctggatctgtgcagaactgacgaccgttctctctgcggtgcttatt
gcaatccttgcactcaaggcaacgattgatgcatcgctgaagtacatcttcatctgttca
acctcgatgctcttctcattcatcgggatcatcttcctctttgaggcggtcaggaataag
accggtgtcggaagtcttctgtggacagagattgtggatgaagcagccggtctggacagc
ggcatggtctttatcgcctttgtcttcttctttatcgggtttgcagcaaaatcaggcatt
gtgccatttcatacctggcttcctctggctcatgccaaggctccttcagcggtaagtgcg
gttctgtccggtgcaatactcaatatcgggatgtatggaatcctccggatgaccgggatc
atgaaggagacaggggtgttcgggcaggtatcagttctcctgatcgtctttgccatgatt
actatctcggtcgcctgtctctcgatgctcaggcagaagaagcttaagacgcttatcgcc
ttctcatccattgagaatatggggttcatcttgcttggcattggtatcggaagcccggtg
gcactattctgggcactctttcatatgctctcgcattcctgcatcaaagcaggtctgttc
ttctccgccggtatcctccaccgccagtataaggttccgacacggaccggtgaggacgag
atcggagacctcctgctgcttcagccctttgcggcggtaaccgtgatggcagggtgtgca
gctcttatcggaatgcctctcttcccgctctttctctcaaaggtggggatacttctggca
gctgcagcgatctcagtatggattccggcaatagtccttctcctgtttgcctgtgcagga
gtcgccctgctccggttttacctcccggtaatggcggtcaggttcccggccggggaaggt
ccggtgccctatacggcgcctctctccatgaaagttcccattgttctgcttctcctcctt
tcaatcatgattgggaccgtgatgatacctggggaggaagccttccttgctgcggcggtt
gctgatctgggattcggggtgcagctatga

DBGET integrated database retrieval system