KEGG   Methanospirillum hungatei: Mhun_1819Help
Entry
Mhun_1819         CDS       T00325                                 

Definition
(RefSeq) hydrogenase membrane subunit (EC:1.6.99.5)
  KO
K12141  
hydrogenase-4 component F [EC:1.-.-.-]
Organism
mhu  Methanospirillum hungatei
Brite
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Mhun_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2055087..2056556)
Genome map
AA seq 489 aa AA seqDB search
MIAVLYPVVAMVILLLQLLLRTHRSLSLLGVIHPVISLIITLYFIVSPGIWDDSPFFLID
HMSLFVMLTTSIIFAAAALYAVGYIDGLVRSGDLEKRSLRIFYFGFSFLLAATTMAIFTP
NIALFWICAELTTVLSAVLIAILALKATIDASLKYIFICSTSMLFSFIGIIFLFEAVRNK
TGVGSLLWTEIVDEAAGLDSGMVFIAFVFFFIGFAAKSGIVPFHTWLPLAHAKAPSAVSA
VLSGAILNIGMYGILRMTGIMKETGVFGQVSVLLIVFAMITISVACLSMLRQKKLKTLIA
FSSIENMGFILLGIGIGSPVALFWALFHMLSHSCIKAGLFFSAGILHRQYKVPTRTGEDE
IGDLLLLQPFAAVTVMAGCAALIGMPLFPLFLSKVGILLAAAAISVWIPAIVLLLFACAG
VALLRFYLPVMAVRFPAGEGPVPYTAPLSMKVPIVLLLLLSIMIGTVMIPGEEAFLAAAV
ADLGFGVQL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagtcctgtacccggtggttgcaatggtgattcttcttttgcagctgctgctc
cggacacaccggtcactcagccttcttggcgttatccatccggttatttccctcataata
acgctgtattttatcgtatctcctgggatctgggacgattccccgttcttcctcatcgat
cacatgagcctttttgtgatgctcacaaccagcatcatctttgctgcagcagctctgtat
gctgttggatatattgacgggctggtcaggtcaggggatctggagaagagaagtcttcgg
atattttatttcggattctcattcctgcttgccgctacaaccatggcaatcttcaccccc
aatattgccctgttctggatctgtgcagaactgacgaccgttctctctgcggtgcttatt
gcaatccttgcactcaaggcaacgattgatgcatcgctgaagtacatcttcatctgttca
acctcgatgctcttctcattcatcgggatcatcttcctctttgaggcggtcaggaataag
accggtgtcggaagtcttctgtggacagagattgtggatgaagcagccggtctggacagc
ggcatggtctttatcgcctttgtcttcttctttatcgggtttgcagcaaaatcaggcatt
gtgccatttcatacctggcttcctctggctcatgccaaggctccttcagcggtaagtgcg
gttctgtccggtgcaatactcaatatcgggatgtatggaatcctccggatgaccgggatc
atgaaggagacaggggtgttcgggcaggtatcagttctcctgatcgtctttgccatgatt
actatctcggtcgcctgtctctcgatgctcaggcagaagaagcttaagacgcttatcgcc
ttctcatccattgagaatatggggttcatcttgcttggcattggtatcggaagcccggtg
gcactattctgggcactctttcatatgctctcgcattcctgcatcaaagcaggtctgttc
ttctccgccggtatcctccaccgccagtataaggttccgacacggaccggtgaggacgag
atcggagacctcctgctgcttcagccctttgcggcggtaaccgtgatggcagggtgtgca
gctcttatcggaatgcctctcttcccgctctttctctcaaaggtggggatacttctggca
gctgcagcgatctcagtatggattccggcaatagtccttctcctgtttgcctgtgcagga
gtcgccctgctccggttttacctcccggtaatggcggtcaggttcccggccggggaaggt
ccggtgccctatacggcgcctctctccatgaaagttcccattgttctgcttctcctcctt
tcaatcatgattgggaccgtgatgatacctggggaggaagccttccttgctgcggcggtt
gctgatctgggattcggggtgcagctatga

DBGET integrated database retrieval system